SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020471 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020471
Domain Number 1 Region: 781-1018
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 6.93e-90
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000289
Further Details:      
 
Domain Number 2 Region: 455-625
Classification Level Classification E-value
Superfamily Fibronectin type III 1.02e-23
Family Fibronectin type III 0.0024
Further Details:      
 
Domain Number 3 Region: 280-441
Classification Level Classification E-value
Superfamily Fibronectin type III 2.36e-23
Family Fibronectin type III 0.0024
Further Details:      
 
Domain Number 4 Region: 109-232
Classification Level Classification E-value
Superfamily Fibronectin type III 6.41e-18
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 5 Region: 33-97
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000151
Family Fibronectin type III 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020471   Gene: ENSMODG00000016383   Transcript: ENSMODT00000020832
Sequence length 1043
Comment pep:novel chromosome:BROADO5:Un:48585275:48600742:1 gene:ENSMODG00000016383 transcript:ENSMODT00000020832 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGLSPGPWPLLGVVVVLGSWMGSLAVAQDEISALTVDQQTNTSVTLKWESANATFRYNV
SWVKDGELMGSGNISETQYTVKGLEPGTAYEFTVKVEGSSFEMRLNASTVPNEVGELQMV
NRSTSSVSLRWTVPSGPQASNYTYWVSWTGEGIHNWNSTGQTEYEVRGLDAATMYNFTVQ
AERNDVNSSGQSIQVATGKMEGGVQLRWSGNISETQYTVKGLEPGTAYEFTIKEQIVGQG
SILGPLQAQAPNPCYSCQEALPTPPRNSSPLTLVPHHLSVPNEVGELQMVNRSTSSVSLR
WTVPSGPQASNYTYWVSWAGEGVHNQSSTEQTEYEVRGLDAATMYNFTVQAERNDVNSSG
QSIQEATVPNEVGELQMVNRSTSSVSLRWTVPSGPQASNYTYWVSWAGEGILNQSSTGQT
EYEVRGLDAATMYNFTVQAEKNDVNSFGQSIQVATVPNEVGELQMVNRSTSSVSLRWTVP
SGPQASNYTYWVSWAGEGILNQSSTEQTEYEVRGLDAATMYNFTVQAGRNDVNSSGQSIQ
VATVPNEVRELQMVNRSNSSVSLRWTVPSSPQASDYIYWVSWAGEGVPGDRINTLEDRYT
VSRLEPGTLYQFTVYSVSHEVQSAPQTLDRFTGEAGPGRRPEWRGGRRPATLPLTSAGPS
PRGPPARPTRCPGSPGRTSPTTPASRPGDLTPRDQVLLCGEVGDSGPGPQSRAGIHAFID
KRNRPRWEGAASRGSCPCQSSGNAPGAAGTPRLSSAIPPSLCLRLSLKQQLALESLEQLQ
TAASALENKSKNRFSNVLPYDWARVPLQPIPGDPGSDYINASFLPGLCDPREFIATQGPL
PQTVGDFWRLVWEQRIRSMVVLTNCVKCEHYWPLDAQPCNHGRLRVTLRGETVAEHWTVR
DLHLFHMDLKQTLCVRQFHYTVWPDHGVPHSPDPLLAFQALLRQWLEQSPEGGPPIVHCS
AGVGRTGTFIALDVLLRQLQKHGHVGVQSFVRRMRRSRPLMVQTEVQYIFLYQTLLRHMQ
QSEDQEGSFYENVDATKAYEQEL
Download sequence
Identical sequences H9H8L0
ENSMODP00000027136 ENSMODP00000020471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]