SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020689 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020689
Domain Number 1 Region: 34-297
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.64e-85
Family Eukaryotic proteases 0.0000552
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020689   Gene: ENSMODG00000016568   Transcript: ENSMODT00000021056
Sequence length 297
Comment pep:novel chromosome:BROADO5:6:148038457:148041183:-1 gene:ENSMODG00000016568 transcript:ENSMODT00000021056 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILSPLSLSSPHSQNQKCPIFLVLFTTTPPSQGLGAVFHQVCPYVSPGCGQPRMSNRIVGG
RDAREGEWPWQASLQYQRSHVCGASLISRQWVLTAAHCFPRPVKLSDYRIRLGEFRLARP
SPQALSSQLLRVVLNANFTEEGAQGDIALVQLRRPVSFSARVRPVCLPAPGAFPTPGTRC
WVTGWGSLRQGGESMPLPGSRPLQGVQVPLIDRWTCDRLYHVDSNIPLTEPIVLPGTLCA
GYARGSRDACQGDSGGPLVCIQSGRWVLEGVVSWGKGCALPNRPGVYTSVAYYWPWI
Download sequence
Identical sequences F7D3P7
ENSMODP00000020689 ENSMODP00000020689 13616.ENSMODP00000020689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]