SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020693 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020693
Domain Number 1 Region: 17-120
Classification Level Classification E-value
Superfamily Immunoglobulin 1.09e-16
Family V set domains (antibody variable domain-like) 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020693   Gene: ENSMODG00000016575   Transcript: ENSMODT00000021060
Sequence length 126
Comment pep:novel chromosome:BROADO5:Un:52399928:52415222:1 gene:ENSMODG00000016575 transcript:ENSMODT00000021060 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPVFISVLLFSGVTSEVVVPQGPSLTVIQGRTITLTRSSSAGALITGLSPHWFPQKSGLV
PSTLIYRPNNPSSGVPACFFGSLLGNKGALTIPEVQSEDEAGYDCSIWHNSSCHWEGGGT
CSVVAG
Download sequence
Identical sequences H9H6Z8
ENSMODP00000020693 ENSMODP00000020693 13616.ENSMODP00000020693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]