SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020847 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020847
Domain Number 1 Region: 412-547
Classification Level Classification E-value
Superfamily TIMP-like 1.33e-25
Family Netrin-like domain (NTR/C345C module) 0.011
Further Details:      
 
Domain Number 2 Region: 186-282
Classification Level Classification E-value
Superfamily Immunoglobulin 1.68e-21
Family I set domains 0.015
Further Details:      
 
Domain Number 3 Region: 363-418
Classification Level Classification E-value
Superfamily BPTI-like 9.79e-20
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0019
Further Details:      
 
Domain Number 4 Region: 299-359
Classification Level Classification E-value
Superfamily BPTI-like 0.00000000000227
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.016
Further Details:      
 
Domain Number 5 Region: 104-154
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000291
Family Ovomucoid domain III-like 0.031
Further Details:      
 
Domain Number 6 Region: 23-73
Classification Level Classification E-value
Superfamily Elafin-like 0.00000068
Family Elafin-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020847   Gene: ENSMODG00000016704   Transcript: ENSMODT00000021214
Sequence length 553
Comment pep:novel chromosome:BROADO5:6:150774802:150779739:1 gene:ENSMODG00000016704 transcript:ENSMODT00000021214 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPALLLILTLLSGLADGASLQPEPMSHLGVCPNQLNPNLWVDAQSTCEREYHVDQDCGGF
EKCCTNVCGLRSCVAARFADGSSAAQAPAATCESFVCPQQGSDCDIWDGQPVCKCRDRCE
KEPNFTCASDGLTYYNRCYMDAEACLRGLRLSVVPCKYVFSWPHTSPGPPETTAPPTPGA
APDVPIPPALYSNPFHQSVYAGGTASFHCDVSGRPPPDITWEKQSDQRENFIMRPDQMYG
NVVVTNIGQLVIYNARPEDAGLYTCTARNAAGLLRADFPLSVIQREAPRGVPPAPSPPPP
APSECLKEPDRQTCPGTSGRVRWHFDAKRGGCITFQDYGCDGGNGNRFETYEACQRACAR
GPGDACILPAVQGPCRSWEARWAYSPLLKQCHSFVYGGCEGNANNFESRESCEDTCPFPR
TLPCKACRLKSKMALSLCRSDFAIVGRLTEVIEEPDAGIARFALEGVLKDDKMGLKFFDT
KYLEVTLSGIDWDCPCPNMTAGDGPLVIMGEVHDGVAVLHPSSYVRAASDKRVKKILELI
EKKACELLNRFQD
Download sequence
Identical sequences F7D2F1
XP_003341725.1.35504 ENSMODP00000020847 ENSMODP00000020847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]