SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020864 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020864
Domain Number 1 Region: 957-1252
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.79e-78
Family Protein kinases, catalytic subunit 0.00000000114
Further Details:      
 
Domain Number 2 Region: 324-486
Classification Level Classification E-value
Superfamily L domain-like 2.21e-43
Family L domain 0.00000251
Further Details:      
 
Domain Number 3 Region: 27-161,221-236
Classification Level Classification E-value
Superfamily L domain-like 1.02e-39
Family L domain 0.00000384
Further Details:      
 
Domain Number 4 Region: 484-604
Classification Level Classification E-value
Superfamily Fibronectin type III 7.62e-24
Family Fibronectin type III 0.0000435
Further Details:      
 
Domain Number 5 Region: 764-912
Classification Level Classification E-value
Superfamily Fibronectin type III 3.19e-22
Family Fibronectin type III 0.00035
Further Details:      
 
Domain Number 6 Region: 606-674,775-797
Classification Level Classification E-value
Superfamily Fibronectin type III 1.71e-17
Family Fibronectin type III 0.00028
Further Details:      
 
Domain Number 7 Region: 190-330
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000173
Family Growth factor receptor domain 0.0000256
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020864   Gene: ENSMODG00000016712   Transcript: ENSMODT00000021231
Sequence length 1308
Comment pep:novel chromosome:BROADO5:2:191952601:191983677:-1 gene:ENSMODG00000016712 transcript:ENSMODT00000021231 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTASSSWLWGACLLMNFLPLGFGLDTPEVCPSLDIRTEVAELRRLENCTVVEGYLQILLI
FTATGEDFQGLSFPRLTQVTDYLLLFRVYGLESLRDLFPNLAVIRGNRLFFSYALVIFEM
PHLRDVGLPGLGAILRGAVRVEKNQELCHLSTVDWGLLQPTTDANHIVGNKLGEECADVC
PGMLGTEEPCIRTTVNGRTDYRCWTSGHCQRVCPCARGLACTPRGECCHPQCLGGCSRPN
DPQACVACRHFHFGGTCHSACPRGTYRYEAWRCVTADYCASLRALPDLPGHASDFVIHQG
SCLAQCPPGYTHNDSSIFCLKCEGLCPKECKVGTKTIDSLQAAQELVGCTHVKGSLILNL
RQGYNLEAELQQSLGLVETITGFLKIKHSFALISLGFFRNLKLIQGDSMVDGNYTLYVLD
NQNLQQLGQWAEAGLSIPVGKIYFAFNPRLCLEHIYQLEEVTGTRGRQNKAEINPRTNGD
RAACKTRSLRFVSNVTESDRILLRWERYEPLEARDLLSFIVYYKESPFQNATEHMGPDAC
GAPNWNLLDVELPLSRTQEPGVTLAPLKPWTQYAVFVRAITLSMAEDSPHQGAQSPIIYL
RTLPAAPTVPLDVISTSNSSSHLLVRWKPPTLRNGNLTYYLVLWQRLAEDADLYLNDYCQ
RGLRLPTSSTDTRFDQEEGEPLAEAEPGCCPCQSPSPEQPQQPALEAHEASFQKKFENFL
HNAITLPRSPWKVTSLNKSPQRDPGRYRRASRAPGEGGNSSDFGIQDKVPRERAVLSGLR
HFTEYRIDIHACNHAAHTVGCSAATFVFARTMPHREADSIPGKVAWKPASKSSVLLHWPE
PPDPNGLILKYEIKYKRLGEEATVLCVSRLRYAKFGGVHLALLPPGNYTARVRATSLAGN
GSWTDGLAFYIPGSEEEESGGLHVLLTVTPVGLLLLIVLAALGFFYSKKRNSGGYPNGTL
YASVNPEYFSTSDMYVPDEWEVPREQISVIRELGQGSFGMVYEGLAQGLEAGEAPTPVAL
KTVNELASLRERIEFLKEASVMKAFKCHHVVRLLGVVSQGQPVLVIMELMTRGDLKSYLR
SLRPEAENNPGLPRPGLGDMIQMAGEIADGMAYLTANKFVHRDLAARNCMVSQDFTVKIG
DFGMTRDVYETDYYRKGGKGLLPVRWMAPESLKDGIFSTHSDVWSFGVVLWEIVTLAEQP
YQGLSNEQVLRFVMDNGILDEPEGCPPQLRELMSRCWQQNPRQRPTFLQILDSIKDELRP
SFRLLSFYYSPESRGGRGSLAPPDTDPDTHLSPEPPPDFSPPNGSLGH
Download sequence
Identical sequences F7CI05
ENSMODP00000020864 ENSMODP00000020864 XP_001375165.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]