SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020990 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020990
Domain Number 1 Region: 139-254
Classification Level Classification E-value
Superfamily C-type lectin-like 1.05e-37
Family Link domain 0.0016
Further Details:      
 
Domain Number 2 Region: 256-339
Classification Level Classification E-value
Superfamily C-type lectin-like 1.03e-23
Family Link domain 0.002
Further Details:      
 
Domain Number 3 Region: 44-147
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000116
Family I set domains 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020990   Gene: ENSMODG00000016817   Transcript: ENSMODT00000021360
Sequence length 341
Comment pep:novel chromosome:BROADO5:2:191603480:191606256:1 gene:ENSMODG00000016817 transcript:ENSMODT00000021360 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPNQLILYALWSLLFRLGVAIYHKGTGNPAPHPGPHYLLPPIHEVIHSRRGATVTLPCVL
GTPPPSYKVRWSKVEPGELRETLILITNGHHARGYGPLGDRARMRRGHRLDASLVITGVA
LEDEGRYRCELINGLEDESLALTLRLEGVVFPYQPSRGRYQFNYYEAKQACAEQDGRLAT
YPQLYQAWTEGLDWCNAGWLLEGSVRYPVLTARTPCGGRGRPGIRSYGPRDKQRDRYDAF
CFTSALRGHVFFVPGRLTLAEASGACVRRGAVLAKVGHLYAAWKFSGLDRCDGGWLADGS
VRFPITTPRPRCGGLPDPGVRSFGFPSPEQPAYGTYCYAET
Download sequence
Identical sequences F7FIK2
ENSMODP00000020990 13616.ENSMODP00000020990 XP_001375002.1.35504 XP_007482142.1.35504 XP_007482143.1.35504 ENSMODP00000020990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]