SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020991 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020991
Domain Number 1 Region: 527-712
Classification Level Classification E-value
Superfamily Fibronectin type III 2.63e-30
Family Fibronectin type III 0.0000151
Further Details:      
 
Domain Number 2 Region: 192-290
Classification Level Classification E-value
Superfamily Immunoglobulin 2.69e-24
Family I set domains 0.018
Further Details:      
 
Domain Number 3 Region: 400-501
Classification Level Classification E-value
Superfamily Fibronectin type III 8.82e-24
Family Fibronectin type III 0.00000167
Further Details:      
 
Domain Number 4 Region: 298-388
Classification Level Classification E-value
Superfamily Immunoglobulin 8.48e-23
Family I set domains 0.0085
Further Details:      
 
Domain Number 5 Region: 98-193
Classification Level Classification E-value
Superfamily Immunoglobulin 5.05e-22
Family I set domains 0.0049
Further Details:      
 
Domain Number 6 Region: 12-106
Classification Level Classification E-value
Superfamily Immunoglobulin 2.41e-21
Family I set domains 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020991   Gene: ENSMODG00000016811   Transcript: ENSMODT00000021361
Sequence length 1367
Comment pep:novel chromosome:BROADO5:7:808091:1081760:1 gene:ENSMODG00000016811 transcript:ENSMODT00000021361 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSLFSVLRDDFRQNPTDVVVAAGEPAILECQPPRGHPEPAIYWKKDKVRIDDREERISI
RGGKLMISNTRKSDAGMYTCVGTNMVGERDSDPAELTVFERPTFLRRPINQVILEEEAIE
FRCQVQGDPQPTVRWKKDDADLPRGRVDVKEDHTLRIKKALSSDEGTYVCIAENRVGRVE
ASATLTVRARPVAPPQFVVRPRDQIVIQGRTVTFPCETKGNPQPAVFWQKEGSQNLIFPN
QPLQPSSRYSVSPTGDLTITNIQRSDAGYYICQALTVAGSILAKAQLEVTDVLTDRPPPI
ILQGPANQTLAVDGTALLKCKTTGDPLPIISWLKEGFTFLGRDPRTSLQEQGTLQIKNLR
ISDSGTYTCVATSSSGETSWSAVLDVTESGATISKPYDFNELPGPPSKPQVTDVSKNSVT
LSWQPGSPGSLPASAYIIEAFSQSVSNSWQTVANHVKTTLYTVRGLRPNTIYLFMVRAIN
TQGLSDPSPMSDPVRTQDISPPAQGVDHRQVQKELGDVAVRLHNPVVLTPTTVQVTWTVD
RQPQFIQGYRIFYRQTSGPQAPSTWQNLDVKVSTERSAVLGHLKKGATYEIKVRPYFNEF
QGMDSESKSAHTTEEAPSAPPQSVTVLTIGSHNNTSISVSWDPPPPDHQNGVIQEYKIWC
LGNETRFHINKTVDASMRSVVIGGLFPGVQYQVEVAASTSAGTGVRSDPQPIVIGGRNEV
IITENNNSITEQITDVVKQPAFIAGIGGACWVILMGFSIWLYWRRKKRKGLSNYAVQSFT
FTPAVTFQRGDGGLMSNGSRPGLLDASDPSYPWLADSWPATSLPVNSSSSGPNDIGNFGR
GDVLPPGPGQGDKTATLLSDGAIYSSIDFTTKTTYNSSSQITQATPYATTQILHSNSIHE
LAVDLPDPQWKSSIQQKTDLIGFGYSLPDQNKGNNGGKGGKKKKNKNSSKAPKNNGSNWA
NVPLPPPPVQPLPGTELEHYAADQQEAGYDSDGWCPPLPVQTYLHQGMEDELEEDDDRVP
TPPVRGVASSPAISFGQQSTATLTPSPCEEMQPMLQAHLEELTRAYQFDMTKQAWHIQSN
TQPPQPPVPPLGYVSGTLISDLETDIPDDDDGEDDDDNDDEEEDEALEITRPLRGQDQTP
GSSMDNLDSSVTGKAFSSSQRPRPTSPFSTDSNTSTALNQSQRPRPTKKHKGGKLDQPPL
PHRREGMTDDLPPPPDPPPVQGLRHQIVPGQHGGNMESSAERKGSSLERQHASPIDETKS
SKDRQARTSLEWQQQTQEWISTTEPQEDFRKVPHKQAFESEEALVPYSKPSFPSPGGHSS
SGTASSKGSTGPRKGEVLRGSHQRNASDLLDVGYLGPTSQGPFTGEL
Download sequence
Identical sequences F7FIJ7
ENSMODP00000020991 ENSMODP00000020991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]