SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021041 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021041
Domain Number 1 Region: 676-862
Classification Level Classification E-value
Superfamily Fibronectin type III 3.43e-26
Family Fibronectin type III 0.0000989
Further Details:      
 
Domain Number 2 Region: 250-346
Classification Level Classification E-value
Superfamily Immunoglobulin 6.38e-25
Family I set domains 0.0024
Further Details:      
 
Domain Number 3 Region: 341-439
Classification Level Classification E-value
Superfamily Immunoglobulin 4.61e-24
Family I set domains 0.055
Further Details:      
 
Domain Number 4 Region: 164-258
Classification Level Classification E-value
Superfamily Immunoglobulin 2.79e-22
Family I set domains 0.012
Further Details:      
 
Domain Number 5 Region: 446-541
Classification Level Classification E-value
Superfamily Immunoglobulin 4.08e-22
Family I set domains 0.017
Further Details:      
 
Domain Number 6 Region: 552-652
Classification Level Classification E-value
Superfamily Fibronectin type III 5.59e-21
Family Fibronectin type III 0.0000376
Further Details:      
 
Domain Number 7 Region: 58-158
Classification Level Classification E-value
Superfamily Immunoglobulin 7.55e-21
Family I set domains 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021041   Gene: ENSMODG00000016857   Transcript: ENSMODT00000021411
Sequence length 1640
Comment pep:novel chromosome:BROADO5:7:1826286:2153793:-1 gene:ENSMODG00000016857 transcript:ENSMODT00000021411 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCVCASVADPQIWGRVTPSWNETACRRHARTMIAESAHFYLFGLICLCSGSRLRQEDFPP
RIVEHPSDLIVSKGEPATLNCKAEGRPTPTIEWYKGGERVETDKDDSRSHRMLLPSGSLF
FLRIVHGRKSRPDEGVYICVARNYLGEAVSHNASLEVAILRDDFRQNPSDVMVAVGEPAV
MECQPPRGHPEPTISWRKDGSPLDDRDERITIRGGKLMITYTRKSDAGKYVCVGTNMVGE
RESEVAELTVLERPSFVKRPSNLAVTVEDSAEFKCEARGDPVPTVRWRKDDGELPKSRYE
IRDDHTLKIRKVMAGDMGSYTCVAENMVGKAEASATLTVQEPPHFVVKPRDQVAALGRTV
TFQCEATGNPQPAIFWRREGSQNLLFSYHPPQSSSRFSVSQTGDLTITNVQRSDVGYYIC
QTLNVAGSIITKAYLEVTDVIADRPPPVIQQGPGNQTVAVDGTLVLSCVATGSPVPTILW
RKDGVLVPTQDSRIKQLDTGALQIRYAKLGDTGRYTCIASTPSGEATWSAYIEVQEFGIP
VQPPRPTDPNLIPSAPSKPEVTDVSRNTVTLSWQPNLNSGATPTSYIIEAFSHASGSSWQ
TVAENVKTETFATKGLKPNAIYLFLVRAANAYGLSDPSQISDPVKTQDVPPTSQGVDHKQ
VQRELGNVVLHLHNPTVLSSSSIEVHWTVDQQSQYIQGYKILYRPSSAPHGDSEWLVFEV
RTPTQNSAILPELRKGASYEIKARPFFNEFQGADSDVKLAKTLEEAPSAPPQSVTISKND
GNGTAILVTWQPPPEDTQNGMVQEYKVWCLGNESRYHINKTVDGSTFSVIIPSLVPGVRY
SVEVAASTGAGSGVKSEPQFIQLDSHGNPVSPEDQVSLAQQISDVVKQPAFIAGIGAACW
IILMVFSIWLYRHRKKRNGLTSTYAGIRKVPSFTFTPTVTYQRGGEAVSSGGRPGLLNIN
EPAAQPWLADTWPNTGSSHNDCSINCCTASNGNSDGNLTTYSRPADCIANYNNQLDNKQS
NLMLPEPTVYGDVDLSNKINEMKTFNSPNLKDGRLVTAPGQPTPYATTQLIQSGISNNIN
NGHGEASEKPWKASSQPKQEAASIQYNIMEQNKLNKDYRTTDTIPPTIPYNQSYDQNTGG
SYNSSDRGSSTSGSQGHKKGARTPKLPKQTGMNWADLLPPPPAHPPPHSHSEDYSLSVDE
SYDQEIPCPVPPARMYLQQEELEEEDERGPTPPVRGAASSPAAVSYSHQSTATLTPSPQE
ELQPMLQDCPEDIGHGQHHPDRRRQPVSPPPPPRPISPPHTYGYISGPLVSDMDTDVPEE
EEDEADMEVAKMQTRRLLLRGLEQTPASSVGDLESSVTGSMINGWGSASEEDNISSGRSS
VSSSDGSFFTDADFAQAVAAAAEYAGLKVARRQMQDATGRRHFHGSHCPRPTSPVSTDSN
VSAALMQRARPAKKQKHAPGHPRREVYTDDLPPPPVPPPALKSPTVQSKGHLEGRPMMLP
KLPHVEARADRSAERKGGGYKGREALDGRPASDTRTNPGEPRDAQELQGDGKARGNKASR
RDLPPPKTHLVQEDILPYCRPTFPTSNNPRDPSSSSSMSSRGSGRQRDQANIGRRNVAEM
QVLGAYEKEVDNEELEETES
Download sequence
Identical sequences F6QGK3
ENSMODP00000021041 ENSMODP00000021041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]