SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021142 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021142
Domain Number 1 Region: 14-279
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.24e-86
Family Eukaryotic proteases 0.00000179
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021142   Gene: ENSMODG00000016945   Transcript: ENSMODT00000021515
Sequence length 290
Comment pep:novel chromosome:BROADO5:6:155062071:155066071:-1 gene:ENSMODG00000016945 transcript:ENSMODT00000021515 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRTQHWNLDMMFSLLFLTLPLLGSSVPLIQDREQVGIVGGQEALEDEWPWQVSLRQDVG
SFWMHFCGGSLIHPQWVLTAAHCIGTVPIEPSAIKIQLRERQLYYKDKLLPLAKIIVSPR
YTFANKGWDIALLKLKTPVELSSHIKLISLPNATETFPLNSECWVTGWGDLDSGVSLPPP
YTLRKVRVPLLDPKVCDAKYHKKTYTGPSVKIITDDMLCAGKVNIDSCQGDSGGPLVCKV
GDTWKQAGVVSWGIGCGMRNKPGIYTRVSSHVDWINENVFSNSSMNPLRS
Download sequence
Identical sequences F6V6G0
ENSMODP00000021142 ENSMODP00000021142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]