SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021161 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000021161
Domain Number - Region: 35-105
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.0016
Family Transglutaminase, two C-terminal domains 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021161   Gene: ENSMODG00000016964   Transcript: ENSMODT00000021534
Sequence length 183
Comment pep:novel chromosome:BROADO5:2:190870879:190877581:-1 gene:ENSMODG00000016964 transcript:ENSMODT00000021534 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLVFAVLCLFSTAKSEEGARLLASKSLLNRYAVEGKDLTLQYNIYNVGSSAALDVELS
DDSFPPEDFGIVSGMLNVKWDRIAPASNVSHTVVLRPLKAGYFNFTSATITYLAQEEGPV
VVGFTSAPGQGGILAQREFDRRFSPHFLDWAAFGVMTLPSIGIPLLLWYSSKRKYDTPKT
KKN
Download sequence
Identical sequences F6V4W6
ENSMODP00000021161 13616.ENSMODP00000021161 XP_007482110.1.35504 XP_007482111.1.35504 ENSMODP00000021161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]