SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021172 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021172
Domain Number 1 Region: 617-907
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.46e-83
Family Protein kinases, catalytic subunit 0.00000000113
Further Details:      
 
Domain Number 2 Region: 29-201
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.78e-73
Family Ephrin receptor ligand binding domain 0.000000916
Further Details:      
 
Domain Number 3 Region: 325-530
Classification Level Classification E-value
Superfamily Fibronectin type III 6.46e-41
Family Fibronectin type III 0.0000598
Further Details:      
 
Domain Number 4 Region: 910-979
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000000606
Family SAM (sterile alpha motif) domain 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000021172
Domain Number - Region: 256-325,363-382
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000216
Family Growth factor receptor domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021172   Gene: ENSMODG00000016972   Transcript: ENSMODT00000021545
Sequence length 984
Comment pep:novel chromosome:BROADO5:7:12624613:13023099:1 gene:ENSMODG00000016972 transcript:ENSMODT00000021545 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDCHISILLFLICSARSCFGELILQPTNEVNLLDSKAIQGELGWISYPAHGWEEISGVDE
HYTPIRTYQVCNVMDHSQNNWLRTNWVPRNSAQKIYVELKFTLRDCNSIPLVLGTCKETF
NLYYMESDDDHGVKFREHQFTKIDTIAADESFTQMDLGDRILKLNTEVREVGPVSRKGFY
LAFQDVGACVALVSVRVYFKKCPFTVKNLAMFPDTVPMDSQSLVEVRGSCVNNSKEEEPP
RMYCSTEGEWLVPIGKCLCNAGHEERGYVCQACRPGFYKASAGNLKCSKCPPHSSTQEDG
AVDCRCENNYFRADKDPPSMACTRPPSAPRNVISNINETSVILDWSWPLDTGGRKDVTFN
IICKKCGGSVRQCEPCSSNVHFLPRQFGLSNTTVTVIDLLAHTNYTFEIDAVNGVSDMSS
SPRQFAAVTITTNQAAPSPVTIIRKDRTSRNSVSLSWQEPEHPNGIILDYEVKYYEKQEQ
ETSYTILRARGTNVTISGLKPDTTYVFQIRARTAAGYGTNSRKFEFETSPDSFSISSENS
QVVMIAISAAVAIILLTVVVYVLIGRFCGYNKSKHGTEEKRLHFGNGHLKLPGLRTYVDP
HTYEDPNQAVHEFAKELDATSISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIKTLKVGY
TDKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGSLDSFLRKHDAQFT
VIQLVGMLRGIASGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAAY
TTRGGKIPIRWTSPEAIAYRKFTSASDVWSYGIVLWEVMSYGERPYWEMSNQDVIKAVDE
GYRLPPPMDCPAALYQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPSSLKIITNAAARPS
NLLLDQSSVDIPGFRTPGDWLNGIRTGQCKDIFTGVEYSSCDTIAKISTDDMKKVGVTVV
GPQKKIISSIKALETHTKNGPVPV
Download sequence
Identical sequences F6UM70
XP_007500838.1.35504 13616.ENSMODP00000021172 ENSMODP00000021172 ENSMODP00000021172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]