SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021179 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021179
Domain Number 1 Region: 55-552
Classification Level Classification E-value
Superfamily Sema domain 2.35e-179
Family Sema domain 0.0000000000194
Further Details:      
 
Domain Number 2 Region: 548-600
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000209
Family Plexin repeat 0.0023
Further Details:      
 
Domain Number 3 Region: 616-698
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000686
Family I set domains 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021179   Gene: ENSMODG00000016975   Transcript: ENSMODT00000021552
Sequence length 792
Comment pep:novel chromosome:BROADO5:8:142789407:143026646:1 gene:ENSMODG00000016975 transcript:ENSMODT00000021552 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIKLALSKRRDFLAMNAKKDQREKCGSQDLHPLHAFVMLSMIVVLLPVIGTSKQNIPRLK
LSYKDLLLSNSCIPFLGSSEGLDFQTLLLDEERGRLLLGAKDHIFLLSLVDLNKNFKKIY
WPAAKERMELCKLAGKDPYTECANFIRVLQSYNRTHVYVCGTGAFHPICGYIDLGTHKED
LMFKLDTHNLESGRLKCPFDPQQPFASVMTDEYLYAGTASDFLGKDTAFTRSLGPSHDHH
YIRTDISEHYWLSGAKFIGTFPIPDTYNQDDDKIYFFFRESSQEGSTSDKTILSRVGRVC
KNDVGGQRSLINKWTTFLKARLICSIPGNDGADTHFDELQDVFLLPTKDERNPVVYGVFT
TTSSIFKGSAVCVYSMADIRAVFNGPYAHKESADHRWVQYDGRIPYPRPGTCPSKTYDPL
IKSTRDFPDDVISFIKRHPVMYKSVYPVAGGPTFTRINVDYRLTQIVVDHVIAEDGQYDV
MFLGTDIGTVLKVVSIAKEKWNMEEVVLEELQVFKNPSLILNMEMSLKQVTTMIHWSRDG
LVQLSLHRCDTYGKACADCCLARDPYCAWDGNACSRYAPTSKRRARRQDVKYGDPITQCW
DVEDSISHETADEKVIFGIEFNSTFLECIPKSQQASIKWYIQRSGEEHREELKPDERVIK
TEYGLLIRSLQKKDSGLYYCKAQEHTFVHTIVKLTLNVIENEQMENSQKAEHEEGRGKDS
LAESRLRYKDYMQILSSPNFSLDQYCEQMWHREKRRQRNKGGAKWKHVQEMKKKRNRRHH
KDHEQLPRAVAT
Download sequence
Identical sequences F6ULW1
ENSMODP00000021179 ENSMODP00000021179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]