SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021189 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021189
Domain Number 1 Region: 325-422
Classification Level Classification E-value
Superfamily Immunoglobulin 1.3e-27
Family C1 set domains (antibody constant domain-like) 0.00052
Further Details:      
 
Domain Number 2 Region: 109-206
Classification Level Classification E-value
Superfamily Immunoglobulin 1.63e-22
Family C1 set domains (antibody constant domain-like) 0.0026
Further Details:      
 
Domain Number 3 Region: 222-318
Classification Level Classification E-value
Superfamily Immunoglobulin 1.15e-20
Family C1 set domains (antibody constant domain-like) 0.0041
Further Details:      
 
Domain Number 4 Region: 5-59
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000548
Family C1 set domains (antibody constant domain-like) 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021189   Gene: ENSMODG00000016985   Transcript: ENSMODT00000021562
Sequence length 430
Comment pep:novel chromosome:BROADO5:Un:60027601:60036725:-1 gene:ENSMODG00000016985 transcript:ENSMODT00000021562 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALPSAPNLFSLSPCLNSGVEDAPVAVGCLAKDFLPDSINFSWTYQNQSAISHTDLKIFPS
QMITCNFEGNKTPQLKAQDILIPSKSNHLSRVLTSPFAGLCFYPDTTSSSPNVTVYIPPR
DAFSNSGLRKSKLICQVTDFRPREIKLTWLREGRPVSSGFSTGQVLPDGSGTYFLQSSLT
INESDWLSQSTFTCRVDHLNAQFQKNVSSSCAISTDSPIEAFAIPPSFASIFVTKSAKLT
CVVTNLPTYDSLSISWTRKDGQLLKTKVKVSSSHPNGTFTAEGEATVCAEEWNSGEAFKC
IVTHSDHPVPLKKEIFKPQEVDLHAPSVYLLPPNPEELSLRESATVTCMMKDFSPPDVFV
QWMHKGQPIPSEKYVTSSPHQDPQKGGRYFSYSILTVSEAQWNSGDPFTCVVAHEALPLS
STERTVDKST
Download sequence
Identical sequences H9H723
ENSMODP00000021189 ENSMODP00000021189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]