SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021197 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021197
Domain Number 1 Region: 1-462
Classification Level Classification E-value
Superfamily Sema domain 6.02e-171
Family Sema domain 0.000000000072
Further Details:      
 
Domain Number 2 Region: 458-512
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000279
Family Plexin repeat 0.002
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000021197
Domain Number - Region: 533-613
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000375
Family V set domains (antibody variable domain-like) 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021197   Gene: ENSMODG00000016990   Transcript: ENSMODT00000021570
Sequence length 715
Comment pep:novel chromosome:BROADO5:8:145005410:145200950:1 gene:ENSMODG00000016990 transcript:ENSMODT00000021570 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLDEYQERLFVGGRDLVYSLNLDRVSEGYREIHWPSTALQKEECMMKGKDASECANFVR
VLHHYNRTHLLTCGTGAFDPLCAFIRVGHQLEGYQFQLETHRFERGRGRCPFDPNSSYTS
TLIGSELFAGLYSDYWGRDAAVFRSLGRLAHIRTEHDDERLLKEPKFVGSYMIPDNEDQD
DNKVYFFFTEKALESENNAHTIYTRVGRICANDMGGQRILVNKWSTFLKARLVCSVPGMN
GIDTHFDELVDIFLLHTRDNKNPVIFGLFNTTSNIFRGYAICVYHMASIRAAFNGPYAHK
EGPEYHWSLYEGKVPYPRPGSCASKVNGGKYGTTKDYPDDAIRFARSHPLMHQPVKPVHK
RPILVKTDGKYNLKQIAVDRVEAEDGQYDVLFIGTDSGVVLKVITIYNQETESMEEVILE
ELQVFKVPVPIISMEISSKRQQLYIGSESAVAQIRFHQCDMYGTACADCCLARDPYCAWD
GISCSRYYPTGTHAKRRFRRQDVRHGNAAQQCFGQQFVGEVLDKTEERLAYGIEYNSTLL
ECTPRSLQAKVIWFVQKARETRKEEVKTDDRVVKMDLGLLFLRLHKIDAGTYFCQTVEHS
FVHTIRKITLEVVEEERVEEMFNKDYEEEVSHKMPCPAQSSIPQGSKPWYKEFLQLIGYS
NFQRVEEYCEKVWCTDKKRKKLKMSPSKWKYATPQEKRLRAKAEHYRLPRHALDF
Download sequence
Identical sequences F6U5D8
ENSMODP00000021197 ENSMODP00000021197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]