SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021304 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021304
Domain Number 1 Region: 28-517
Classification Level Classification E-value
Superfamily Sema domain 3.14e-180
Family Sema domain 0.0000000000639
Further Details:      
 
Domain Number 2 Region: 513-564
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000331
Family Plexin repeat 0.0021
Further Details:      
 
Domain Number 3 Region: 581-661
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000266
Family I set domains 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021304   Gene: ENSMODG00000017075   Transcript: ENSMODT00000021678
Sequence length 753
Comment pep:novel chromosome:BROADO5:8:148779349:148958870:1 gene:ENSMODG00000017075 transcript:ENSMODT00000021678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTFLAIHMLIGAFVYSGCVKGSSQPQARVYLTFNELRETRTSEYYSLSNNPLDYRILLMD
EDQDRIYVGSKDHILSLNINNISQDPLSIFWPASANKVEECKMAGKDPTHGCGNFVRVIQ
AFNRTHLYVCGSGAFSPVCTYLNRGRRSEEQVFMIDSKCESGKGRCSFNPNVNTVSVMIN
EELFSGMYIDFMGTDAAVFRSLTKRNAVRTDQHNSKWLSEPMFVDAHVIPDGTDPNDAKV
YFFFKERLTDNSGSTKQIHSMIARICPNDTGGQRSLVNKWTTFLKARLVCSVMDEDGTET
YFDELEDVFLLETDNPRTTLVYGIFTTSSSVFKGSAVCVYHLSDIQTVFNGPFAHKEGPN
HQLIPYQGRIPYPRPGTCPGGAFTPNMRTTKEFPDDVVTFIRNHPLMYNPIYPIHKRPLI
IRIGTNYKYTKIAVDRVNAADGRYHVLFLGTDRGTIQKVVVLPTNSTASGELILEELEVF
KNKAPITTMKISSKKQQLYVSSNEGISQVSLHRCHIYGTACADCCLARDPYCAWDGSSCS
RFYPTGKRRSRRQDVRHGNPMTQCRGFNLKAYRNAAEIIQYGVKNNTTFLECTPKSPQAS
IKWLLQKDKDRRKEVKLNERIIATEQGLLIRSVQDSDQGLYHCIATENSFKQTIAKINFK
VLDSEMVAFVTDKWSPWTWASSVRALQFHPKDFVGAFSHSEMQMINQYCKDTRQQSASPQ
GDESQKIRGDYGKLKALINSRKSRNRRNQLPGS
Download sequence
Identical sequences F6VKW8
ENSMODP00000021304 XP_001370138.2.35504 ENSMODP00000021304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]