SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021640 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021640
Domain Number 1 Region: 295-392
Classification Level Classification E-value
Superfamily Immunoglobulin 1.31e-26
Family I set domains 0.0095
Further Details:      
 
Domain Number 2 Region: 346-489
Classification Level Classification E-value
Superfamily Fibronectin type III 3.17e-23
Family Fibronectin type III 0.0021
Further Details:      
 
Domain Number 3 Region: 106-197
Classification Level Classification E-value
Superfamily Immunoglobulin 4.43e-19
Family I set domains 0.014
Further Details:      
 
Domain Number 4 Region: 204-298
Classification Level Classification E-value
Superfamily Immunoglobulin 1.83e-17
Family I set domains 0.0061
Further Details:      
 
Domain Number 5 Region: 4-100
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000219
Family I set domains 0.059
Further Details:      
 
Domain Number 6 Region: 479-571
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000738
Family Fibronectin type III 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021640   Gene: ENSMODG00000017339   Transcript: ENSMODT00000022017
Sequence length 581
Comment pep:novel chromosome:BROADO5:2:188127676:188142033:1 gene:ENSMODG00000017339 transcript:ENSMODT00000022017 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SELAFVQEPGDVVALREHPLLLRCQVEGEPPISISWQRDGTPLGNSSGATLMPDGSLHLG
GFPTHRALQGSLLPPASVHEYNCVAQNRYGRLVSRRARVQLASLSRFHQHPESMVVEQGG
VARFQCLIRGVPEPTISWEHNRTALSAAHHRFTLLPAGILQITNVGQSDVGTYRCVARNV
ANTRYSQEAQLALSVSPPRLLQEPEILSGPQNLTLTVHQTAVLECIATGHPRPLVSWSRL
DGRSIGVEGIQVLGTGNLMISDVSVQHSGVYVCAANRPGTRVRRTAQGVLLVQAPPEFVQ
WPQSVSKPPGSSAIFTCVAQGVPEPRLIWLKNGKVLSPGENVRLTHNNSTLMLAGVTPAD
EAIYQCVAENSAGSNQASARLAVTGAPEPPPAPQGLQAAALSASAVRVSWEPPPARDKPS
IIGYVLLLQPEGEPPGREVQEAVSKGTFEHVFTNLDPATTYSVRLRAYSAEGASHDSPPV
HITTMGNAPAALGFSTKVLNATSVQASWELPPQPGLIQGFKLFHRKLPAAHFEGPLLLAS
SASSFLYTDLEPAALYEIKLQAFNGNGDGNSTVRFVSLRDA
Download sequence
Identical sequences F6WFL2
ENSMODP00000021640 13616.ENSMODP00000021640 ENSMODP00000021640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]