SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021708 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021708
Domain Number 1 Region: 6-110
Classification Level Classification E-value
Superfamily Fibronectin type III 4.87e-19
Family Fibronectin type III 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021708   Gene: ENSMODG00000017392   Transcript: ENSMODT00000022086
Sequence length 190
Comment pep:novel chromosome:BROADO5:4:426313378:426316293:-1 gene:ENSMODG00000017392 transcript:ENSMODT00000022086 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SCLPSADSPSAPVNVTIKQLTANSAMVSWDVLDDEVVIGFAISQQKKDVRMLRFIQEVNT
STRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVTFKTPREENRAQCPFLSPTDEVTMK
EMGMKSQQLRTGEVLIIVVVLFMWAGVIALFCRQYDIIKDNEPNNKEKAKSASESSTPEH
QSGGLLRSKV
Download sequence
Identical sequences F6SL20
13616.ENSMODP00000021708 ENSMODP00000021708 ENSMODP00000021708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]