SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021715 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021715
Domain Number 1 Region: 478-658
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.3e-50
Family SPRY domain 0.00074
Further Details:      
 
Domain Number 2 Region: 165-230
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.83e-17
Family B-box zinc-binding domain 0.0000332
Further Details:      
 
Domain Number 3 Region: 2-88
Classification Level Classification E-value
Superfamily RING/U-box 9.34e-16
Family RING finger domain, C3HC4 0.02
Further Details:      
 
Domain Number 4 Region: 373-483
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000011
Family Fibronectin type III 0.0025
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000021715
Domain Number - Region: 109-161
Classification Level Classification E-value
Superfamily RING/U-box 0.0006
Family ZZ domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021715   Gene: ENSMODG00000017399   Transcript: ENSMODT00000022093
Sequence length 667
Comment pep:novel chromosome:BROADO5:7:31710362:31852377:1 gene:ENSMODG00000017399 transcript:ENSMODT00000022093 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METLESELTCPICLELFEDPLLLPCAHSLCFNCAHRILVSHCATNESVESITAFQCPTCR
YVITLSQRGLEGLKRNVTLQNIIDRFQKASVSGPNSPSETRRERAFDSNTMTSSEKVLCQ
FCDQDPAQDAVKTCVTCEVSYCEECLKATHPNKKPFTGHRLIEPIPDSHIRGLMCLEHED
EKVNMYCVTDDQLICALCKLVGRHRDHQVAALSERYDKLKQNLESNLTNLIKRNTELETL
LAKLIQTCQHVEVNASRQETKLMEECDLLIEIIQQRRQIIGTKIKEGKVVRLRKLAQQIA
NCKQCIERSTSLISQAEQSLKENDHARFLQTAKNITERVSMATASSQVLIPEINLNDTFD
TFALDFSREKKLLECLDYLTAPNSPTIREELCTASYDTITVHWTSDDEFSVVSYELQYTI
FTGQANVVSLCNSADSWMIVPNIKQNHYTVHGLQSGTKYIFIVKAINQAGSRNSEPGKLK
TNSQPFKLDPKSAHRKLKVSHDNLTVERDETSSKKSHTPERFTSQGSYGVAGNVFIDSGR
HYWEVVISGSTWYAIGLAYKSAPKHEWIGKNSASWVLCRCNNNWVVRHNSKEIPIEPAPH
LRRVGILLDYDNGSIAFYDALNSLHLYTFDITFAQPVCPTFTVWNKCLTIITGLPIPDHL
DCLEQLP
Download sequence
Identical sequences F6SKS1
ENSMODP00000021715 ENSMODP00000021715 XP_001365220.1.35504 XP_007500998.1.35504 XP_007500999.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]