SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021749 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021749
Domain Number 1 Region: 127-240
Classification Level Classification E-value
Superfamily Fibronectin type III 3.83e-25
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 2 Region: 11-44,82-150
Classification Level Classification E-value
Superfamily Fibronectin type III 4.6e-19
Family Fibronectin type III 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021749   Gene: ENSMODG00000017426   Transcript: ENSMODT00000022128
Sequence length 246
Comment pep:novel chromosome:BROADO5:2:412916768:412937981:-1 gene:ENSMODG00000017426 transcript:ENSMODT00000022128 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SQPVRESLKVQRVEFQSFNLQSILHWLPGSAFTHNNTVYFVQYKIIIYMKTQSSRRGKKK
KENICICKASVTIFPFPSFFYRYGQKEWTNKEECWGIYEIFCDLTNETSDVEEPYYGRVK
ATSAHIHTPWSMTKRFSPWLETKIGPPSISVIQSGRSIQLILQAPNSPYKDRKGRNKSLK
DYYDLIYRVFIINNSQDMKRKLYEGTNEKIEMDIKPGANYCVAAEMYLFELNRSSESTEI
CTFKIQ
Download sequence
Identical sequences F7AIR4
ENSMODP00000021749 ENSMODP00000021749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]