SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021753 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021753
Domain Number 1 Region: 40-143
Classification Level Classification E-value
Superfamily Fibronectin type III 1.14e-28
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 2 Region: 128-247
Classification Level Classification E-value
Superfamily Fibronectin type III 4.69e-28
Family Fibronectin type III 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021753   Gene: ENSMODG00000017429   Transcript: ENSMODT00000022132
Sequence length 563
Comment pep:novel chromosome:BROADO5:2:412753809:412810004:-1 gene:ENSMODG00000017429 transcript:ENSMODT00000022132 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTFRHRRRAAASGLRAPWFLHLVAWLLLFHVLPELSAHCISSGLPKPTNVTFSSVNMNN
ILRWNSPEGLGGAGVVYTVQYLIYGQKKWLNKSECRNMNITSCDLSCETYDYEEQYYGRV
KAIWGKDCSKWVETERFNPWSETQIGPPVVALTPGEKSISVILTAPEKWKINPEDTSVSM
HQIYPSLKYNVSIYNTKANKKWYKFVTNHTLELPQLESNTLYCVSVQSYVLGPLRNSKPS
EKQCITTLKDQTSELKVKIILCYVLPISVTAFIFLIIGYSMYRYIHVGKEKQPTNLVLIY
GTGYDQRLFAPAEKIVVNFITLSIVEDAKTSSKDMNIMGKNSDIPDPNTVKNMQGKSHQE
ESEVKHLGYASKAMGIFCDSEETLHCLSTVQQELLCASKTKDEPIIEYEFDVRPGDIGID
HHDQGINLQDGIPFQGKVMLDSEIALANFGQEALLGSYNPQLRNLQQRTQENTETKEQEE
DEESRILVDWDPQTGKLCIPSLSDCEHVVEEKGSEHSEYNEYPSEGLLSKLYDAQVPHKS
PQENETYLMQFMEEWGLHIQMED
Download sequence
Identical sequences F6ZVC6
XP_007484680.1.35504 ENSMODP00000021753 ENSMODP00000021753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]