SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021804 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021804
Domain Number 1 Region: 183-383
Classification Level Classification E-value
Superfamily Fibronectin type III 4.38e-25
Family Fibronectin type III 0.0028
Further Details:      
 
Domain Number 2 Region: 443-653
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000188
Family Fibronectin type III 0.0049
Further Details:      
 
Domain Number 3 Region: 130-177
Classification Level Classification E-value
Superfamily Elafin-like 0.000000000497
Family Elafin-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021804   Gene: ENSMODG00000017475   Transcript: ENSMODT00000022183
Sequence length 681
Comment pep:novel chromosome:BROADO5:7:34571808:34798015:1 gene:ENSMODG00000017475 transcript:ENSMODT00000022183 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLKDPGVFLTLFLWITASWGCLATAAGLGAAARKQDETLSAVSVYRARCTSRCLSLQIT
RISAFFKHFQNNGSLVWCQTHKQCSKCLEPCKESWELKKNQCQSFCEPLFPKKNYECLTS
CEFLKYILSVKQGDCPAPEKASGFAAACVESCEIDNECSGVKKCCSNGCGHTCQVPKNLY
KGVPLKPRKELRFTELQSGQLEIKWSSKFNISIEPVIYVVQRRWNYGIHPSEDDATNWQT
VAQTTDERVQLSDIRPSRWYQFRVAAVNVHGTRGFTAPSKHFRSSKDPSAPPAPANLRIA
NSTTNSDGSVTVRIIWDMPEEPDIPVHHYKVFWSWTVSSKSVVPSKKKRRKTTDGSQNYV
ILEGLQPNNNYMVEIQAITYWGQVRLKSSKVSLYFTATQATSNKDQLGKTRKGVTEILPP
FQRRRPTRLLEIGAPFYQDNMLQVKVYWKKNEDASVNRYHVQWFAESCTHNETSEPEKAT
GMAHENYIILQDLAFSCKYKVTVQPARPKGRLKAESIFFTTPPCSALKGKNHKHNSCPGE
GGPALSKVLAKPENLSASFVVQEVNITGHFSWKMSKANLYQPMTGFQVTWAEVTTESRQN
SLPNSIISQSQILPADHYVLTVPNLRPSTLYRLEVQVLTTGGEGPATIKSFRTPDLLSSS
PHRPHLKQHHPHHYKPSPEKY
Download sequence
Identical sequences F7FF48
ENSMODP00000021804 ENSMODP00000021804 XP_001381237.1.35504 XP_016280284.1.35504 13616.ENSMODP00000021804

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]