SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021807 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000021807
Domain Number - Region: 112-206
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00114
Family Hermes transposase-like 0.012
Further Details:      
 
Domain Number - Region: 4-30
Classification Level Classification E-value
Superfamily C-terminal domain of mollusc hemocyanin 0.0392
Family C-terminal domain of mollusc hemocyanin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021807   Gene: ENSMODG00000024811   Transcript: ENSMODT00000022186
Sequence length 231
Comment pep:novel chromosome:BROADO5:3:243809501:243810196:1 gene:ENSMODG00000024811 transcript:ENSMODT00000022186 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LNDAEWKWHLAFLTDITEILNSFNVQLQGKGKLICDMQSHVKAFEVKLGLLIKQVKEKNF
CHLPLTQNLLAEKPLIAFPKETCVDLLKKLQKEFQFRFKELHLHEQDILLFHNPFSIDIE
NVDTIYQMELTELQNHDSLKHAFKSSSLPNFYTSLPSKTYPNLRNHALKMATIFGSTHVC
EQTFPRMKHLKSPTRSRLMETHLYHLLQLAVTNMKPDIDHLISQKQAHSSH
Download sequence
Identical sequences F7FF38
13616.ENSMODP00000021807 ENSMODP00000021807 ENSMODP00000021807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]