SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022022 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022022
Domain Number 1 Region: 707-781
Classification Level Classification E-value
Superfamily SH3-domain 1.31e-17
Family SH3-domain 0.00007
Further Details:      
 
Domain Number 2 Region: 1426-1494
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000249
Family SH3-domain 0.0013
Further Details:      
 
Domain Number 3 Region: 1310-1383
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000617
Family SH3-domain 0.0013
Further Details:      
 
Domain Number 4 Region: 871-1006
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000228
Family Fibronectin type III 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022022   Gene: ENSMODG00000017663   Transcript: ENSMODT00000022409
Sequence length 1500
Comment pep:novel chromosome:BROADO5:3:510924455:510929473:-1 gene:ENSMODG00000017663 transcript:ENSMODT00000022409 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRQLQQQLHRERDCAVRQARDLQRQLADELLNRGYGGRQGGGGSGGAFNSSMAGGAAQCR
CRLQDVLAKLRWETDGEQAARIRHLQAALDVERSLFLKYILENFHWDPAAVLSGPAVRSQ
NRTPNTEPAIAMAIISGAATPALEGAGELPPGLSSRAAVTGPAAAPAPTLAERVRSSTLP
SRPRSLDSLCPPRPRAPGLCLDNTSRSLDGSPGRAQSPPGSGEPEDRSRLQLGGGEKGPE
AEGAPPTMPSPRPTAYSELVKQNSELAEALDTLARHCSGLRHENSQLRRGLPEADEKVQR
LKLKNVELAGIAKRLEERARKLHETNLRTPAAGPPPGPAAGNPSRSAVELCRQAFARQRA
KDLTEQTSALQAKDKQIEDLRQECRDLQARMAACQATAGQGSAQWLNVNDFDHLLRESQK
EVLRLQRQVTLQKCFKGSHAQQAQQAQEAQELKLQLQALEEKLSERQKCCESLQLDVGKV
QQRLQEAEGLLQRLTTENNRLAQENSRFQEKMQWAEKVDSENSDLRGRLEQVTKDRDAAT
LLTAQLQQQVSQVESSRQKLEKELQEALATLAAQQEEVQRQQRDQEQLQREHEEALQALQ
AQIRELERPSIQKAKEIRRSQLPRGKWAKKVTRPLEGPGLPDSGPAVQKASTQASATNAG
PGPLGLLASPTPQALTASAAAAVPSDPAPEPESPTTDSHSGHSGHSGHDPSKLKIFLARY
NYDPYAGPNEQPEAELALTAGEYIYIFGDMDEDGFYSGELMNGQTGLVPSNLVEQISDSE
ILNFQLPEGSDLCLDPSQEVKPLGGGGESTSPEVDRELWQNIRAGAQKQVTVEELDLKTR
AYRISVQSVMERGCSNPLACSFLVGQDFCLAPTRLRLKSLSPTSAEISWLYSNSNYPHMV
RLNEQEHSLAEAGVCRYVFPDLQPSSRYCVHVEVRPPGEASGKPWKEMASSIAFTTPLAG
PPDPPLDVLVECHSSPGSLLVSWIPVTIDSAGSSNGVPVTGYAVYADGQKVTEVASPTAG
NVVLEFSQLQRPKLFQEVSVRTTSHYGESLDSVPAQIPGEWCKQASAYPSPQAFPVNHNC
GDPAHPHIPAPSRLPVPTGQEKSVLASFNTKASSPFPAGCGRPKVAVAWDGLLEDACRRR
SPKPSEGELLSPRDAGAPPGPGEARTPSPLSFGRKDAYGPKAGKDCKLWGLRHISDGPPA
GEERSADTPKGSSSQLPEAYAVVTSPEEEDQYVTPWGARTIGPKKEIRLGRGASRPAGRK
KEAPPPPPRPLLYQSSSEKMTKILKTGPVGPGAALWFRPPENNALKGKTANHPVRVFVAL
WDYDPQLMSANHATAQEELTFHRGQILKVWGDRDPDGFYHGECSGRMGYIPGNLVSEVQV
EGSDVLKQLLQQGHLPSEVSLDGLVGLPTQPPGPQKSFSVARGGPRRAQLWHPQTMVAAF
DYQPRKSSSLSVTEELTLSAGDVVTVLGSVDDNGFLYGELNGQRGLVPWNLLKTPALNGE
Download sequence
Identical sequences F6YJE9
ENSMODP00000022022 13616.ENSMODP00000022022 ENSMODP00000022022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]