SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022053 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022053
Domain Number 1 Region: 27-121
Classification Level Classification E-value
Superfamily Immunoglobulin 6.99e-22
Family C1 set domains (antibody constant domain-like) 0.0000676
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022053   Gene: ENSMODG00000017688   Transcript: ENSMODT00000022440
Sequence length 123
Comment pep:known chromosome:BROADO5:1:202719414:202732335:1 gene:ENSMODG00000017688 transcript:ENSMODT00000022440 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRLFLFALLGHLCFLPYLDAITSESSPPRVQVYSRYPPDSDKSNFLNCYVSGFHPPQIT
IELLKDGKKMENVEQSDLSFSKDWTFNLLVSAPFDPNSNSEFACKVTHSTLNEPKVVKWD
KDN
Download sequence
Identical sequences F7G5N8
ENSMODP00000022053 13616.ENSMODP00000022053 ENSMODP00000022053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]