SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022143 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022143
Domain Number 1 Region: 35-220
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.19e-66
Family Ephrin receptor ligand binding domain 0.00000139
Further Details:      
 
Domain Number 2 Region: 655-816
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.76e-32
Family Protein kinases, catalytic subunit 0.0000037
Further Details:      
 
Domain Number 3 Region: 349-395,430-558
Classification Level Classification E-value
Superfamily Fibronectin type III 1.96e-28
Family Fibronectin type III 0.00062
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000022143
Domain Number - Region: 278-346,387-419
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000994
Family Growth factor receptor domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022143   Gene: ENSMODG00000017759   Transcript: ENSMODT00000022532
Sequence length 860
Comment pep:novel chromosome:BROADO5:4:421337105:421374248:-1 gene:ENSMODG00000017759 transcript:ENSMODT00000022532 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESGACPSPQRLLICLQPLFLLLLLGPSRPGSAEEVVLLDSKESQAELGWTALPSNGWEE
ISGVDENDRPIRTYQVCNVLEPNQNNWLQTGWIGRRGGQRIFIELKFTLRDCSSIPGVAG
SCKETFNLYYTEAEAEAGAGVEGEGKAGAALGGTLLESRQRKVATIAADESFTQGDLGER
KMKLNVEVREIGPLSRDGFHLAFQDVGACVALVSVRVYYKQCLATVQNLAAFPDTVAEAA
FSSLVEVTGTCVAHSEGEPGRPPPRMHCSADGEWLVPVGRCSCSAGFQEREESCEACPPG
FYKVSPRRPLCSPCPEHSSALANASTLCVCQDSYSRSPADPPSASCTRPPTAPRDLVYRL
SRSTLLLRWNPPEDSGGRSDITYTVLCQRCGEDDPGVDQGQGFGQGSEGAEGTCEPCGPS
VSFVPRQTGLRERTVTLLHLLPHSRYTIRVAALNGVSGLGAVGTTYAQVTVPTGLAGSSG
VTEIHPDRVEPKSVSLSWEEPGFPGVPGANNTEYEIQYFEKGQREQTYATVRTGAPAVTV
NNLKPATLYVFQIRAASPSLSPEIGNFTPSIEVETLVEAGSGSRKQNPAVVAVIVAVTVL
LILGFGLSFLAIWKRQCIYGKGFRGGNDDELYFHFKVPTRRTYIDLENSADPMQALHLFA
KELDSSNVSVHKIIGTGQFGDMCSGCLKLPGGRSLLVAVHTLCDGASEKQKLRFLAAACA
LGQFDHSNIVRLEGVITRGITMMIVTEFMGNGALDDFLRRYDGQLTVKQLVGLLPGVASG
MRYLSEMGYVHRGLAARHVLVSNGLDCKISGFGQGPQDQAEAVYTTLVRGERERGRERDR
ERERDRDREINRVIKRQNDR
Download sequence
Identical sequences F7E4M9
ENSMODP00000022143 ENSMODP00000022143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]