SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022203 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022203
Domain Number 1 Region: 118-225
Classification Level Classification E-value
Superfamily Fibronectin type III 4.36e-28
Family Fibronectin type III 0.0000137
Further Details:      
 
Domain Number 2 Region: 24-117
Classification Level Classification E-value
Superfamily Immunoglobulin 1.67e-25
Family C2 set domains 0.00041
Further Details:      
 
Domain Number 3 Region: 442-631
Classification Level Classification E-value
Superfamily Fibronectin type III 5.49e-18
Family Fibronectin type III 0.0028
Further Details:      
 
Domain Number 4 Region: 245-329
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000839
Family Fibronectin type III 0.00019
Further Details:      
 
Domain Number 5 Region: 353-432
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000317
Family Fibronectin type III 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022203   Gene: ENSMODG00000017810   Transcript: ENSMODT00000022592
Sequence length 866
Comment pep:novel chromosome:BROADO5:4:419478707:419500636:-1 gene:ENSMODG00000017810 transcript:ENSMODT00000022592 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWPGAWNLLGTILLFQFSKGLQDCAGISLSASVIPLGASITASCTINPNCTLTEKAIRIV
WRLDLEQLPEGWQHQREDGTLESNITLPHLNLTHAVLSCCLLLPGTLQVIEQAELQAGYP
PQPPNNFSCIMNLTAQVLTCQWKSGPSTHLTTIFTVKSYKSKGNCQSLEEPIPDCIPRAG
EENQCSIPRSQFHMYQKIEIWVKAENMLGEAESPHLCINPMEVVKLEPPILQAAKAMLDP
GSSLPQPGCLQLQWKKARQNKHLEQTCDLRYQHPGELNWVLMSPFLSFSPQNEGEHSLCG
LHFGTRYVLQMRCIRWPMSGHWSDWSPSLELTTREWPPSVRLDVWWRRRVQKLDTTMRDI
QLLWKPVPTKEISSRIQGYLVFPISRREDGVSPPLCNTTELSCVFQLPETAQEVVLTAYN
TAGESPPTTVIFWECEGSSVSSIHTSAPDAQSLWVAWEHPPGQTLPRAYVIEWCLAPVQP
EVDCDGNWKIESNGSSTGTLLDENIMPFQLYKIAVSSLYHDTAGCPQYIYAYSQEKGPSH
APKLKLMQIGRTWAELEWEPGAPELGKSPITQYTVFWTNTQDEKSITIPNASSRSYILHG
LAPTRMYHVHLMASNQAGSINSTDLTLMTTAFDEKDTTVLWILIIIFSVMIFCIITLVCL
YKNHKMKNQFWPNVPDPAHSSLGQWVPTIFPGEIIHLSSLRDPGMPPVSKIIVLKEEEKK
PPPQTIGSDEETKNLPHLVQAYILQGDPFLPEPHPNSNDPIQYGKVMGNQGYQSQHESPA
GLYLRSDSTQPLLADLTPSPKVYENMWFQRSPLASRVPSSQGFPEEDSDDSAFLPRCPQG
PLLDFPLLQGLRIEGAEGLGSLYNPL
Download sequence
Identical sequences F6ZY07
ENSMODP00000022203 XP_007492877.1.35504 ENSMODP00000022203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]