SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022366 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022366
Domain Number 1 Region: 901-1183
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.47e-85
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000487
Further Details:      
 
Domain Number 2 Region: 514-697
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000747
Family Fibronectin type III 0.0042
Further Details:      
 
Domain Number 3 Region: 418-553
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000779
Family Fibronectin type III 0.0073
Further Details:      
 
Domain Number 4 Region: 707-795
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000796
Family Fibronectin type III 0.0024
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000022366
Domain Number - Region: 328-401
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0373
Family Fibronectin type III 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022366   Gene: ENSMODG00000017933   Transcript: ENSMODT00000022756
Sequence length 1205
Comment pep:novel chromosome:BROADO5:8:103397714:103532784:-1 gene:ENSMODG00000017933 transcript:ENSMODT00000022756 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLFFLPKQNATPFHVTVQEDNSIVVSLEASDVVSSSSVYVVKITGESKNYFFQFEEFNST
LPAPVVFNASYHGLYYIITLVVVNANVVIKPARSITVLTKPLPVTSVSIYDYKPSPETGV
LFEIHYPEKYNVFTRVNISYWEGKDFRTMLYKDFFKGKTVFNHWLPGICYSNITFQLVSE
ATFNKSTLVEYSGVSHEPKQHRTAPFPPQNISVRIISLNKNNWEEESGSFPEESFLRPQD
LIEKEKLLHFTDDPPEISSANTSSGWPDFNSSDEETTLQPYWWDSETVTPENEDEFVSVL
PREDKNNNTVSLIEKSTSAPLSFFPVQMILNWLPPKPPTAFDGFHIHIEREENSTEFLTV
NEEAHEFVTELNEPGKYKLSVTTFSSSGSCETRGSQSAKTISFYISPLGEWIEELTEKPQ
HVRVNVLSSTTALMSWTSSQERDNNNTIVSVVSLTCQKQKESQRLEKHYCTQVNSSKSII
ENLVPGAQYQVVIYLRKGPLIGPPSDPVTFAIVPTGIKDLMLYPLGPTAVVLSWTRPYLG
VFRKYVVEMFYFNPATMISEWTTYYEIAATVSLTASVRIANLLPAWYYNFRVTMVTWGEP
ELSCCDSSTISFITAPVAPEITSVEYFNNLLYISWMYGDDTTNLSHSRMMHWMVVAEGKK
KIKKSVTRNVMTAVLNLPPGDVYNLSVTACTERGSNTSLPHLVKLEPAPPKSLFAVNKTQ
TSVTLLWVEEGVVDFYKVFCHQAGSNEEIKLQEPISVFSHVVTISSLLPATVYNCSVTSF
SHNSASVPTFIAISTMVTEMNPNVVVISVLAILSTLLIGLLLVTLIILRKKHLQMARECG
AGTFVNFASLERDGKLPYNWRRSIFAFLTLLPSCLWTDYLLAFYINPWSKNGLKKRKLTN
PVQLDDFDAYIKEMAKDSDYKFSLQFEELKLIGLDIPHFAADLPLNRCKNRYTNILPYDF
SRVRLVSMNEEEGADYINANYIPGYNSPQEYIATQGPLPETRNDFWKMVLQQKSQIIVML
TQCNEKRRVSITHWFSSLSLMERPSDIEQLSASLKSILGSWKEYFKKYRIGYSHADEVQD
VMHFNYTAWPDHGVPTTNAAESIMQFVQMVRQQSTKTRGPMIIHCSAGVGRTGTFIALDR
LLQHVCDHEYVDILGLVSDMRSYRMSMVQTEEQYIFIHQCVQLMWMKKKRQFCISDVIYE
NVSKS
Download sequence
Identical sequences F7EJQ2
13616.ENSMODP00000022366 ENSMODP00000022366 ENSMODP00000022366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]