SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022497 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022497
Domain Number 1 Region: 34-127
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000014
Family I set domains 0.068
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000022497
Domain Number - Region: 143-274
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0222
Family LacY-like proton/sugar symporter 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022497   Gene: ENSMODG00000018045   Transcript: ENSMODT00000022890
Sequence length 321
Comment pep:novel chromosome:BROADO5:4:67433493:67505943:-1 gene:ENSMODG00000018045 transcript:ENSMODT00000022890 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWPLVAVLLLGTVCGGSAQLTFNSTRIVEKTICNETVILPCIVSNLELRKLKAMYVKWKH
KGKEIFTFDGVDNKFNSSDDFKSATIAFSHLTEGNASLQLKASDAVPGNYTCEVTESNRE
GEIIVELRYHMVSWFHPKENILIVIFPILAILLFWGQFGIVTLKYKSNCTSEKTIGLIIA
GLFLTVVVIVGAVLFVPGEYSVKNASGLGLIVIPTVTLVVLQYCLFTTAFGMTLFAIGIL
ILQFLGYILAVIGLSLCITECSPTQGPLMISGLGIIALAELLGLVYMKFVASNQKTIPPS
RKAVEEPLNAFKESKGMMNDE
Download sequence
Identical sequences F6ZW27
ENSMODP00000022499 XP_007493673.1.35504 ENSMODP00000022497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]