SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022543 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022543
Domain Number 1 Region: 63-168
Classification Level Classification E-value
Superfamily Immunoglobulin 4.31e-16
Family V set domains (antibody variable domain-like) 0.043
Further Details:      
 
Domain Number 2 Region: 263-360
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000499
Family I set domains 0.0092
Further Details:      
 
Domain Number 3 Region: 165-260
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000212
Family C1 set domains (antibody constant domain-like) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022543   Gene: ENSMODG00000018084   Transcript: ENSMODT00000022937
Sequence length 547
Comment pep:novel chromosome:BROADO5:4:71797100:71868239:1 gene:ENSMODG00000018084 transcript:ENSMODT00000022937 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARTPGPAPPYPGGGKAQLSSASPPGAQLLLLPPPLLLLLLFPLFFFSQFCGTLAGPIIV
EPYITAVWGKNVSLRCIIEVNETITQVSWEKIQGKSSQTVAVHHPQYGFSVQEAYQGRVL
FKNHSLNDATIVLHNIDFSDSGEYICKAVTFPLGNAQSSTTVTVLVEPTVSLKKGPYPLI
DGGNETVAAICTAATGKPVAQIDWEGDLGEMESTVTSFPNETMTIVSQYKLIPTKFARGR
RITCVVRHPALEKEIRYSFMLDILYAPEVSVTGYDGNWFVGRMNVNLRCNADANPPPSQS
KWSRLDGQWPEGLETLENTLYFLNPLTYNYSGVYICKVTNSLGQRSAQKIIYILDPPTTT
TQPPTIQWRFSTVEFEDINAPPKKLPFPLSTLTTIKDGAIGTVIGGAVGGVLFLILVSVL
VGIFFYRRRRTFRGDYFAKNYIPPSDMQKESQIDVLHQDELDSYPDSVKKESKHPVNNII
SKDYLEEPEKSQWNNVDNLTRFERPMDYYEDIKMGMKFVGDESYDDNEDDLVSHVDGSVI
SRREWYV
Download sequence
Identical sequences F7FTI1
ENSMODP00000022543 XP_001362370.1.35504 13616.ENSMODP00000022543 ENSMODP00000022543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]