SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022562 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022562
Domain Number 1 Region: 571-828
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.98e-80
Family Eukaryotic proteases 0.0000435
Further Details:      
 
Domain Number 2 Region: 92-219
Classification Level Classification E-value
Superfamily SEA domain 3.4e-21
Family SEA domain 0.0099
Further Details:      
 
Domain Number 3 Region: 234-353
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000994
Family Spermadhesin, CUB domain 0.0035
Further Details:      
 
Domain Number 4 Region: 353-463
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000563
Family Spermadhesin, CUB domain 0.0042
Further Details:      
 
Domain Number 5 Region: 469-506
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000117
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 6 Region: 545-584
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000284
Family LDL receptor-like module 0.0024
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000022562
Domain Number - Region: 505-541
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000183
Family LDL receptor-like module 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022562   Gene: ENSMODG00000018097   Transcript: ENSMODT00000022956
Sequence length 832
Comment pep:novel chromosome:BROADO5:4:73223735:73338953:1 gene:ENSMODG00000018097 transcript:ENSMODT00000022956 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKPNCDDSAKPADLNVSNISVQMVTPPEKLPVRKPPRRPPRKPIGKVKLKKKKVKKVPF
WNIQNKIILFTAFLIILAVITWTLLWLHISQSESKDAFYFVGLFRIANIEFLPEYRQKES
REFLSVAQNVQQVMNLVYTTSAFSKFYKKSVVADVSNNNEGGLLVHFWLVFVVPHAKVFC
EECVAAILKDSIQTSIVNRTSVGSLQGLAVDMDSVVLNAGLRSDYSSAIGIDKGCAHDLY
ADHPFQHFPLEISATSGHLMCHFKLTASVGYLIRLSIVSLQIEADNCITDSLTIYDSLMP
IKSTILYRICEPTRSLMSFVSTNNLMLVTFKSPRVRKLSGIRGYFEVIPEEKCGSTILAK
ESIGFEGKISSPYFPSYYPPKCKCTWKFQTPLPSLGIALKFHNYTITKKNMKGCDHGWWE
INEHMYCGSYIDHQTVFRIASSVGHVQLQCSSRLSDKPLLVEYGSYNISQPCPARHFRCS
TGLCVPQARRCDGINDCFDESDELFCGMLKPACNVSAFQSQAPLVCDGFRDCEDGQDEEN
CTQRIPCNNQTFKCGNDVCFKKKNAKCDGTVDCPDGSDEKGCSCSRTASSLLHRIIGGSD
TQEGGWPWQVSLHFVGSAYCGASVISREWLLSAAHCFQGSRLSDPRPWTAHLGMYIQGNA
KFVSPVRRIVVHEYYNSQTFDYDIALLQLSTAWPENMKQLIQPICIPPLGQKVHSGEKCW
ITGWGRRNEADSKGSTILQQAEVELIDQTLCVSTYGIVTARMLCAGVMSGKRDACKGDSG
GPLSCQRKSDGKWILTGIVSWGRGCGRADFPGVYTRVSNFVPWIHRYVPSLL
Download sequence
Identical sequences F7FFR4
ENSMODP00000022562 ENSMODP00000022562 XP_007493721.1.35504 13616.ENSMODP00000022562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]