SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022599 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022599
Domain Number 1 Region: 22-132
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000084
Family V set domains (antibody variable domain-like) 0.065
Further Details:      
 
Domain Number 2 Region: 127-211
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000216
Family C1 set domains (antibody constant domain-like) 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022599   Gene: ENSMODG00000018120   Transcript: ENSMODT00000022996
Sequence length 258
Comment pep:novel chromosome:BROADO5:4:74305614:74356684:-1 gene:ENSMODG00000018120 transcript:ENSMODT00000022996 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAQAPSSNTSTTQMSQQISTKETYNVSAQVDTKTVLSCYIHQIKSLVMLNWEILLRDTV
PCIIAYRKDTNETKETNCSGEGINWESRADWDHELRINPVTIANDGDYKCEFVTPEGNFE
RLYHLSVVVPPLVNLSNEGDESAVCKAAAGKPAARITWVPEGVCVTSNETHDNRTVTVTS
SCSWKSFNGSRATCFISHLTGNSNLSIELNWSFTLSSLPSISSSTLISLYICLFVLLGLI
IILGFIFIWRTICHRLVA
Download sequence
Identical sequences F7F1Q7
ENSMODP00000022599 ENSMODP00000022599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]