SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022611 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022611
Domain Number 1 Region: 29-144
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000092
Family V set domains (antibody variable domain-like) 0.061
Further Details:      
 
Domain Number 2 Region: 150-235
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000067
Family I set domains 0.043
Further Details:      
 
Domain Number 3 Region: 241-325
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000265
Family V set domains (antibody variable domain-like) 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022611   Gene: ENSMODG00000018136   Transcript: ENSMODT00000023009
Sequence length 484
Comment pep:novel chromosome:BROADO5:8:108172191:108179976:1 gene:ENSMODG00000018136 transcript:ENSMODT00000023009 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLWDVRALVLLHLLLVTRAGTHIPRKEVQMVWAKEGVPVQLPCTLSNNFSAGYSFLQKVT
VTWWHRHQNRTPQASWYRVFSVGPAGLRSVSPPFHPRVQLGEFSLHRGDFSLWLRPASLT
DAGEYRAQVHYETGELRCHLLLRVGRASVTASPPGPLVTSSMVLLKCSFNRSDLPGDVLW
SRGGIPLIPSSRHFPFEGLLFLSNITVSDSGPWDCCIIYPDGFNISVTHQLNVLGLEPLE
HKTVYVGEGSKVELPCHLSPGPGTLPGLVAQWTLPRGRGSSLVSGDDRNSFALKLDHVSR
AQAGLYRCDVSFQGHQLSAVITLAVITVTAKSFGSSSSQKGLLCEVTPMFKQEHFLWTTL
DNQTLENPPGPWLEIGDEEQHVNQWQCQVYQGAQQCGAVVYNLGLQETGAQLSERTPKAV
KGGKQLSLLLSLGILLLLLFGAGAVFLLRQRKLPRRFSALEDAVQKFQRQNIAEQMESES
YCQT
Download sequence
Identical sequences F7CXS2
ENSMODP00000022611 ENSMODP00000022611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]