SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022622 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022622
Domain Number 1 Region: 605-807
Classification Level Classification E-value
Superfamily Fibronectin type III 1.43e-31
Family Fibronectin type III 0.00000665
Further Details:      
 
Domain Number 2 Region: 315-406
Classification Level Classification E-value
Superfamily Immunoglobulin 2.07e-22
Family I set domains 0.0049
Further Details:      
 
Domain Number 3 Region: 236-325
Classification Level Classification E-value
Superfamily Immunoglobulin 1.27e-17
Family I set domains 0.028
Further Details:      
 
Domain Number 4 Region: 470-573
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000408
Family Fibronectin type III 0.002
Further Details:      
 
Domain Number 5 Region: 35-122
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000466
Family I set domains 0.012
Further Details:      
 
Domain Number 6 Region: 137-213
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000048
Family I set domains 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022622   Gene: ENSMODG00000018140   Transcript: ENSMODT00000023020
Sequence length 1111
Comment pep:novel chromosome:BROADO5:4:74768149:74873697:1 gene:ENSMODG00000018140 transcript:ENSMODT00000023020 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LHGMTMMPRRKRPTVTITCLILAAASCFGHLGEVPQVTVQPTSTVQKHGGPVILGCVVEP
PWVNITWRLNGKELNSSDDELGILITRGTLVIAALNNHTVGRYQCVARMPAGAVASVPAT
VTLANLQDFKFEGQHIIEVDEGNTAVIACDLPESHPKAQVRYSVKQEWLEASRDNYLIMP
SGNLQIVNASQEDEGMYKCAAYNPVTQEVKTSVSSDRLRVRRSTAEAARIIYPPEAQTII
VTKGQSLILECVASGIPPPRVTWAKDGSSIVGYNKTRFLLSNLLIDTTSEEDSGSYRCMA
DNGVGEPGAAVILYNVQVFEPPEVTMELSQQIIPWGQSAKFTCEVRGNPQPSVYWLRNAV
PLASSQRLRLSRKALRVVSVGPEDEGVYQCMAENEVGSAQAMAQLKTARPGTTLKPWREA
KLGSSQSPTPSSRPSSPDRTLRDRAMLLRPRPTALPASLQCTTAKGQVSPAEAPIILSSP
RTSKTDYYELVWRPRHDGGSRAPILYYLVKHRKQVTNSSDEWIISGIPANQHHLTLTRLD
PGSLYEVEMAAYNCAGEGQTAMVTFRTGRRPKPEIVASKEQQIQRDDPGASTQSNNQLDN
SRLSPPEAPDRPTISMASETSVYVTWIPRGNGGFPIQSFRVEYKKLKKVGDWILATSAIP
PSRLSVEITGLEKGTSYKFRVRALHILRESEPSAASRLTVTGYIPCVDRLYGPISLTDAV
NETTIMLKWVYKSASNNNTPIHGFYIYYRPTDSDNDSDYKKDVVEGDRYWHSISHLQPET
SYDIKMQCFNEGGESEFSNVMICETKARKPSGQPGRLLPPTLAPPPILLPDLGDRPGGSG
GPGAMVARSSDLPYLIVGVVLGSIVLIIVAFIPFCLWRAWSKQKQTADLGFPSTALLSSS
CQYTMVPLRGISAPRTNGQPYINGQPYGNGLHMNGACPSAGLGFPGVKTQDYSPGELQQQ
DHTNSLLQGNTVGNGHSQKNHQAIREPDSSPEENTFLYALPDDSTHQLLHAHDDCCHLQE
QPAALCQSETRSASESPRREGLWDSPFQPGPPCCLGLVPVEEVDNPHSLQVRGGEWCPHH
PPGTYLGPDPGRRPSPSPPIHVSFETPPPTI
Download sequence
Identical sequences F7CXD4
13616.ENSMODP00000022622 ENSMODP00000022622 ENSMODP00000022622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]