SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022635 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022635
Domain Number 1 Region: 621-920
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.73e-84
Family Protein kinases, catalytic subunit 0.000000000711
Further Details:      
 
Domain Number 2 Region: 32-204
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.83e-73
Family Ephrin receptor ligand binding domain 0.000000918
Further Details:      
 
Domain Number 3 Region: 331-537
Classification Level Classification E-value
Superfamily Fibronectin type III 2.27e-42
Family Fibronectin type III 0.0000739
Further Details:      
 
Domain Number 4 Region: 915-990
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.59e-22
Family SAM (sterile alpha motif) domain 0.00028
Further Details:      
 
Domain Number 5 Region: 260-321
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000738
Family Growth factor receptor domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022635   Gene: ENSMODG00000018150   Transcript: ENSMODT00000023033
Sequence length 993
Comment pep:novel chromosome:BROADO5:2:351969325:352188211:-1 gene:ENSMODG00000018150 transcript:ENSMODT00000023033 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVFQTRYPSWIILCYIWLLRFAHLGEAQAAKEVLLLDSKAQQTELEWISFPPNGWEEISG
LDENYTPIRTYQVCQVMEPNQNNWLRTNWIAKGNAQRIFVELKFTLRDCNSLPGVLGTCK
ETFNLYYYETDYNTGRNIRENLYVKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSRK
GFYLAFQDVGACIALVSVKVYYKKCWSIIENLAIFPDTVTGSEFSSLVEVRGTCVSSAEE
EAENSPRMHCSAEGEWLVPIGKCICKAGYQQKGDTCEPCGRGFYKSSSQDLQCSRCPTHS
FSDKEGSSRCDCEDGYYRAISDPPYVACTRPPSAPQNLIFNINQTTVSLEWSPPADNGGR
NDVTYRVLCKRCSWEQGECVPCGSNIGYMPQQTGLADNYVTVMDLLAHANYTFEVEAVNG
VSDLSRSQRLFAAVSITTGQAAPSQVSGVMKERVLQRSVELSWQEPEHPNGVITEYEIKY
YEKDQRERTYSTVKTKSTSASINNLKPGTVYVFQIRAFTAAGYGNYSPRLDVATLEEATA
TAVSSEQNPVIIIAVVAVAGTIILVFMVFGFIIGRRHCGYSKADQEGDEELYFHFKFPGT
KTYIDPETYEDPNRAVHQFAKELDASCIKIERVIGAGEFGEVCSGRLKLPGKRDVAVAIK
TLKVGYTEKQRRDFLCEASIMGQFDHPNVVHLEGVVTRGKPVMIVIEYMENGALDAFLRK
HDGQFTVIQLVGMLRGIAAGMRYLADMGYVHRDLAARNILVNSNLVCKVSDFGLSRVIED
DPEAVYTTTGGKIPVRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDV
IKAIEEGYRLPAPMDCPAGLHQLMLDCWQKDRAERPKFEQIVGILDKMIRNPNSLKTPLG
TCSRPISPLLDQNTPDFTTFCSVGEWLQAIKMERYKDNFTAAGYNSLESVARMTIEDVMS
LGITLVGHQKKIMSSIQTMRAQMLHLHGTGIQV
Download sequence
Identical sequences F7CWR4
ENSMODP00000022635 XP_016286676.1.35504 ENSMODP00000022635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]