SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022677 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022677
Domain Number 1 Region: 162-262
Classification Level Classification E-value
Superfamily Immunoglobulin 5.87e-22
Family I set domains 0.013
Further Details:      
 
Domain Number 2 Region: 78-170
Classification Level Classification E-value
Superfamily Immunoglobulin 1.54e-18
Family I set domains 0.019
Further Details:      
 
Domain Number 3 Region: 7-82
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000024
Family V set domains (antibody variable domain-like) 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022677   Gene: ENSMODG00000018185   Transcript: ENSMODT00000023075
Sequence length 309
Comment pep:novel chromosome:BROADO5:4:78320651:78800890:-1 gene:ENSMODG00000018185 transcript:ENSMODT00000023075 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CYVEDKSSKVAWLNRSGIIFAGHDKWSLDPRVELEKRTALEYSLRIQKVDVYDEGSYTCS
VQTQHQPKTSQVYLIVQVPPKISNISSDVTVNEGSNVTLVCMANGRPEPVITWRHLTPTG
REFEGEEEYLEILGITREQSGKYECKAANEVSSADVKQVKVTVNYPPTITESKSNEATTG
RQASLKCEASAVPAPDFEWYRDDTRINSANGLEIKSIEGQSLLMVTNVTEEHYGNYTCVA
ANKLGVTNASLILFKRVLPTIPNPNQEIGTTVHFKQKGPGSVRGINGSISLAVPLWLLAA
SLFCLLSKC
Download sequence
Identical sequences F7BTK4
ENSMODP00000022677 ENSMODP00000022677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]