SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022678 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022678
Domain Number 1 Region: 25-128
Classification Level Classification E-value
Superfamily Immunoglobulin 1.58e-17
Family V set domains (antibody variable domain-like) 0.0029
Further Details:      
 
Domain Number 2 Region: 140-236
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000171
Family I set domains 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022678   Gene: ENSMODG00000018186   Transcript: ENSMODT00000023076
Sequence length 432
Comment pep:novel chromosome:BROADO5:4:82328352:82536779:-1 gene:ENSMODG00000018186 transcript:ENSMODT00000023076 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSRGSPLAPLLLLSLQGIASSLDVLESPGSIQVARGQTAVLPCTFTTSAALINLNVIWM
VIPLSNANQPEQVILYQAGQMSDGAPRFHGRVGFTGTMPATNVSIFINNTQLMDTGTYQC
LVNNRPDTGGRNIGVTGLTVLVPPSVPLCRIQGSQDIGSDVILICSSEEGIPRPTYLWEK
LDNIPRLPPSATQDQIHGTVTLRNISSVSSGLYQCVASNAIGTSTCLLDLQVISPQPRSI
GVIAGVVSSAAIVVILCLILMLVAFFYWRSRNKEEEEEEIPNEIREDDLPPKCTSSAKAY
HAEVSSSENNTLTSSNTYNSRYWNNNPKVHHTMESYGHPGDLHQSFSLHSGSANIPSIYA
NGSHLVPPSVKTLVVTANKAPSPQATSRSNGSISRKPRSQHTHSYAVSQTTLERMGAVPV
MVPAQSRAGSLV
Download sequence
Identical sequences F7BTJ8
XP_007493788.1.35504 ENSMODP00000022678 ENSMODP00000022678

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]