SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022693 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022693
Domain Number 1 Region: 1014-1112
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000223
Family Fibronectin type III 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022693   Gene: ENSMODG00000018198   Transcript: ENSMODT00000023092
Sequence length 1123
Comment pep:novel chromosome:BROADO5:8:109149941:109282336:-1 gene:ENSMODG00000018198 transcript:ENSMODT00000023092 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESTEEPQKKIFKARKTMRVSDRQQLEVVYKVKEELLKTDVKLLNGKHENGDSDLNSPLD
NTDCIDGKDMNGIEDVCLDLEDRKTELKESPSNFLNIDIREEDDDSSLKCATASPKNITY
EPEKDTVPETDNTVPNSNKDDDNLEKSSTDDENLDQRERESPLEDKTIVSDNTETEEEKL
EMSNVPISADLPTEVEKNMNENPLTESAFEEEAISSSMEIGKDAKSEDNKSPGLPETTDE
NVQDDKNESTLDNVDSMETDEIIPILEKLAPAEDELTSFSKTSLIPLEETNPDLGEKLEN
SLGSPSKQESSESLPKEAFLVLSDEEETSGEKDVEVVLPNESSSPDSMCPSSSLIASVPM
TCSFTALQPQVETETKEKDAKLEEEKEAHKEEERPGKNELLSRRKRSKSEDMDNVQSKRR
RYLGEEYEAELQVKITARGDINQKLQKVVQRLLEEKLSALQCAVFDKTLADLKMRVEKIE
CNKRHKTVLTELQAKIARLTKRFGAAKEDLKKRQENPPNPPVSPGKSTANEVVSINNLTY
RNAGTVRQMLESKRNIGENTPSPFQAPVNAVSSASIATPQTAVSGQPKSQTPVTSGSLTA
SVLPAPTTAPVVASTQVSSGNSQPTISLQSLPVILHVPVAVSSQPQLLQGHTGTLVTNQQ
SGNVEFISVQSQSTVSGLTKNPAPLPSTNSTKPNNSPSVPSPSIQRNSPASAAPLGTTLA
VQAISAAHPIAQATRTSLPAVGTSGLYNPANNRSSIQMKIPLAAFGTTAAAPAEPSSTTV
PSRVENQTSKTTDTSVNKRAAETTPQSGKATGSDSGGVIDLTLDDEEVGTSQDPKKLNHT
PVSAISQSAQPLPRPLQPLQPAPLQQTGVPTSGPSQTTIHLLPTAPTTVNVTHRPVTQAT
TRLPIPRVPTNHQVVYTTLPAPPAQAPVRGAVLQNSTVLIRQVNPPNGVTVRVPQAATYV
VNNGLTLGSTGPQLTVHHRPPQVHPEPSRPVHPAPLPEAPQPQRLPPEAASTSLPQKPHL
KLARVQSQNGIVLSWSVLEVDRSCASVDSYHLYAYHEDPSATMPSQWKKIGEVKALPLPM
ACTLTQFVSGSKYYFAVRAKDIYGRFGPFCDPQSTDVISSQSS
Download sequence
Identical sequences F7B6U9
ENSMODP00000022693 ENSMODP00000022693 XP_007503753.1.35504 XP_007503754.1.35504 XP_007503755.1.35504 XP_007503756.1.35504 XP_016281416.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]