SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022694 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022694
Domain Number 1 Region: 62-157
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000104
Family V set domains (antibody variable domain-like) 0.0012
Further Details:      
 
Domain Number 2 Region: 172-256
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000281
Family C2 set domains 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022694   Gene: ENSMODG00000018199   Transcript: ENSMODT00000023093
Sequence length 337
Comment pep:novel chromosome:BROADO5:4:83182915:83223549:-1 gene:ENSMODG00000018199 transcript:ENSMODT00000023093 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRCGSYCNLEKKRKELVFDLRHLEGNLPGLELRMAQPKLLHFMLLCLLYMAHAGLSSGET
KVTRAVKEAVTFPCNYEIPEKERTYYRVYWQHDTKVVQAYVPGRRGEDLIDLSYVNRTVM
EMANNLSVTIFPLQVPDEGTYECIVQRLVGGQYKRVHKQDVQLSISADFPEPTTEVYEET
GYWRMTCSSRQGYPQPKLSWVNNGKVLTSVNTSIFQDPVTKLYDIQSELHINQTNNSLFI
CSIDYGDSRVSANVTLPKGPDSWSGALIIAATLPSIFFLIAMILLVYQCFYKHSEGGLYS
PPQELTSVTTTEEGNGTESPVAHVNSATTSSGRAASV
Download sequence
Identical sequences F7B6U0
XP_007493794.1.35504 ENSMODP00000022694 ENSMODP00000022694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]