SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022804 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022804
Domain Number 1 Region: 26-77,109-166
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000314
Family V set domains (antibody variable domain-like) 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022804   Gene: ENSMODG00000018288   Transcript: ENSMODT00000023207
Sequence length 547
Comment pep:novel chromosome:BROADO5:4:86222548:86288365:-1 gene:ENSMODG00000018288 transcript:ENSMODT00000023207 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMGPEPPPPLLLLFTWLPAGCLSLLVTVQDTERYVTLFASVVLKCDYTTSAQLQDVVVTW
RFKSFCKDPILDYYSASYQAALALGQDPSNDCNDSQRTVRIVAQRRGQNEPVLGVDYRQR
KITIQNRADLVINEVMWWDHGVYYCAIEAPGDTAGDPDKEVKLIVLHWLTVIFIILGAIL
LIVLVSVCWCQCCPQYCCCYVRCPCCPTRCCCPEEALARHRYMKQARALIPQMMEKPLYW
GADRSSQVSSYQMNPLLQRDFSPQASFPQMPGPPTPTHPAAANGVLEYLEKELQKLNPAH
SLPPDHKARVGRHCSMLSSLGSEIVERRIIHLPPLVRDPPSSQMTSDSSHPQWGPQFSRR
PRALEEGQAERRQSHYSNFRQESLEPWPKLKASEHRGRENYKSGRHWTSREEVSHTSWPH
SDSLSDDGSYSRDAHWRPNHSTQRSRSPGRRHRPRQRDSSNRLLSHRHRSYSPPSCHSSW
SSEEEKERQQQQGWKAHRPPQPPSWSEEKPPSYRSLDVIPGKKVRKRGNEERRSERESSH
SGRSVII
Download sequence
Identical sequences F6PWR7
XP_007493835.1.35504 ENSMODP00000022804 ENSMODP00000022804

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]