SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022873 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022873
Domain Number 1 Region: 1476-1761
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.37e-82
Family Protein kinases, catalytic subunit 0.00000012
Further Details:      
 
Domain Number 2 Region: 641-733
Classification Level Classification E-value
Superfamily Immunoglobulin 1.39e-25
Family I set domains 0.004
Further Details:      
 
Domain Number 3 Region: 1347-1462
Classification Level Classification E-value
Superfamily Fibronectin type III 5.02e-25
Family Fibronectin type III 0.00063
Further Details:      
 
Domain Number 4 Region: 1839-1931
Classification Level Classification E-value
Superfamily Immunoglobulin 1.37e-24
Family I set domains 0.0000101
Further Details:      
 
Domain Number 5 Region: 174-266
Classification Level Classification E-value
Superfamily Immunoglobulin 1.67e-24
Family I set domains 0.0041
Further Details:      
 
Domain Number 6 Region: 532-622
Classification Level Classification E-value
Superfamily Immunoglobulin 8.12e-23
Family I set domains 0.0086
Further Details:      
 
Domain Number 7 Region: 1134-1228
Classification Level Classification E-value
Superfamily Immunoglobulin 1.96e-22
Family I set domains 0.019
Further Details:      
 
Domain Number 8 Region: 1268-1365
Classification Level Classification E-value
Superfamily Immunoglobulin 7.67e-22
Family I set domains 0.00000952
Further Details:      
 
Domain Number 9 Region: 45-139
Classification Level Classification E-value
Superfamily Immunoglobulin 1.15e-21
Family I set domains 0.0042
Further Details:      
 
Domain Number 10 Region: 432-525
Classification Level Classification E-value
Superfamily Immunoglobulin 1.83e-21
Family I set domains 0.014
Further Details:      
 
Domain Number 11 Region: 739-833
Classification Level Classification E-value
Superfamily Immunoglobulin 3.47e-20
Family I set domains 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022873   Gene: ENSMODG00000018341   Transcript: ENSMODT00000023278
Sequence length 1948
Comment pep:novel chromosome:BROADO5:4:88820211:89166628:-1 gene:ENSMODG00000018341 transcript:ENSMODT00000023278 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYTGLHEKRLEQAKTMGDVKLVASAHISKGALNSRPSGLSSSALNEAPTFILPPRNLCVP
EGGTARFEGKVRGHPEPQVTWHKNGKRITQGGRFLLSCNIRGQFSLDIQSVKGVDGGKYI
CEASNSSGVQQITVELNVEGNSLKMNREPSGAKALGGRLAAPTDNLPSIWGESPPRFATK
LSRVVAREGQTGRFSCKITGRPQPQVTWLKGDVPLEPNAHIHMLEKNGMQVLEIQEVQLS
DVGVYTCVAVNVAGKASMSSELIIQGTDNTKRSLMNAVVIESSEAKMVTTSKISKSPQPN
CLENVTKSQNHPNFPKTSYRENERAHSSPQPMSDSHPEPLYKLHEKAPEVAPVLQKTSST
IILQPVRTPLETKPQTTGNLPLQGKETMPTAQPTASSLTKKPDSKSQNLQTKIATKKITL
ENRRNKTLDKSPQFLIQPKSQEIQEGDEVKFKSQVSGTPKPTVEWFRDSTFLMEREGIQI
YEEEDGTHCLCLPKAQMEDSGSYSCMAYNIKGRVTSRWMLTVRRPRVSKMPPSFSSVLKD
CTVIEGEDFVLQCTIEGKPTPYVTWLLNDRSIQYAHTTFEDGVAELQVQDALPEDNGLYT
CLAENSSGQASCSARVTVQEKKSSKEIDCSPSVVPSDSSPPIFLKGLSDLEVMDGSQVIM
TVQLSGNPPPEILWLHNGKEIQESEDFHFEQNGSEYSLCIQEVFPEDTGRYTCEAWNSTG
QVQSHAMLTVQEPQDGTQPWFISKPRSVTATPGQNVLISCAIAGDPFPTVQWLRNGRVLT
KDAGYSEVLQNEDVFTMVLKNVQFSHAGQYEIQLRNRVGACSCQVALMLRESPSGALGEA
IPLCLGKEPASCEGLAGGGGGGGSGVGSGGSGGGHHGTLRPLGLGNRLSWRPEEEGEDVR
GVLKRRVETREHTEDRLRQQEVEQLDFRDLLGKKVCTKTLSEEELKEIPAEQMDFRANLQ
RQVKPKTLSEEERKVHSPQQVDFRSVLAKKGGPKAPVLEKTPLPKPATPDFRSVLGNKKK
LPAENGSANAESLNAKAGENAKLVENTRLIGNAKLAETQKPFGGAKLADTQKSIGNATPA
ETKKPIGNTQPAEPPKQAGKEELKNEVINDVNCKRACTGALDSDKTAEKKGTPPGFTEKL
QDLRVAEGSKLILQCQVVAEPPAAITWTLNGKTLKSTKFIALAQEGSLCSVTIEKAMPED
NGTYKCLAKNAAGQAESSCHVTVDEAPSGQMKSRRSKSSIPPVLGTESDATVKKKPAPKT
PPKAALPPQIIQFPEDKKVRAGESVELFCKVAGTQPITCSWMKFRKQIQESEHIKIETSE
NSSKLTILSTRQEHCGCYTLLAENKLGTKQAQVNVTVVDKPDPPAGTPCASDIRSSSLTL
SWYGSSYDGGSAVLSYSVEIWDSVDKEWKELTTCRSTSFSVQNLLPDREYKFRVRAINVY
GTSEPSQESELTTVGEKPEEPKDEVELSDDDEKEPEVDYRTVAINTEQKVADFYDIEERL
GSGKFGQVFRLVEKKTGKIWAGKFFKAYSAKDKENIRQEIDIMNCLHHPKLVQCVDAFEE
KANIVMVLEIVSGGELFERIIDEDFELTERECIKYMKQISEGVEYIHKQGIVHLDLKPEN
IMCVNKTGTRIKLIDFGLARKLENAGSLKVLFGTPEFVAPEVINYEPIGYATDMWSIGVI
CYILVSGLSPFMGDNDNETLANVTSATWDFDDEAFDEISDDAKDFISNLLKKDMKNRLDC
TQCLQHPWLMKDTKNMEAKKLSKDRMKKYMARRKWQKTGNAVRAIGRLSSMAMISGLSGR
KSSTGSPTSPLNADKLETEEDVSQAFLEAVAEEKPHVKPYFTKTILDIEVVEGSAARFDC
KIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIIADVCGDDDAKYTCKAVNSLGE
ATCTAELIVETMGKEGEGEGEGEEEEEE
Download sequence
Identical sequences F6PR65
ENSMODP00000022873 ENSMODP00000022873 XP_007493867.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]