SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023048 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023048
Domain Number 1 Region: 539-654
Classification Level Classification E-value
Superfamily SEA domain 2.22e-20
Family SEA domain 0.0049
Further Details:      
 
Domain Number 2 Region: 227-318
Classification Level Classification E-value
Superfamily SEA domain 0.00000000000123
Family SEA domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023048   Gene: ENSMODG00000018487   Transcript: ENSMODT00000023460
Sequence length 655
Comment pep:novel chromosome:BROADO5:2:328528626:328668724:-1 gene:ENSMODG00000018487 transcript:ENSMODT00000023460 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSCTVTYSATYLFSLLSEHLIKENHVKYKFMEDVSSFDNARTAKVSKVSTIRRIFDLVGH
RSKRSISFPTGIKICPQESMKQILANLQAYYKLRVCQEAVWEAYRIFLDRIPDTNEYQNW
VSACQRETYCIFDIGETFSKSQELQELLQQRLKHQHFPERRDDIPTEKTMEMGIGLTGRL
HELLPLSFPKNLLLAFFKHNQYLFLTQDIETEVTNIISERPLEEMLEFSVNLANQKFKAE
LNDPESPHYQELAAKFQHQMQKIFKTLPGFKEIHVLGFRPKKERDGSSSTVARQLVIFKR
DSSERGRPSGNLSTIHSNEIEKESELQSLEEEELQESSLTSAGLQQLITTALEEDASLEL
GTIQFTDEIEKPPKGLEHDIQSVMITTLDEHSLDATLKPEFTLGHPSSETEEISEQHLSK
TIDSLWSPFGTVSPTQMESLPFFTSWSDFSQPEQPVIFPIDQTTLIPMVASPIYSQSLSK
TTGTSGLNAHVSGNQDSSQELGRTDEVMEDVVYTSTPETSSVETILATTLKYLTTSSMTT
AIKGKELVVFFSLRVTNVPFSNDLFNRSSQEYQELEQQFIQLLLPYLRSNLTGFKHLEIL
NFRNGSVIVNSKMKFTKSVPYNITEAVHCVLEEFCSTAAQNLNLHIDSYSLDIEP
Download sequence
Identical sequences F7C9W3
ENSMODP00000023048 ENSMODP00000023048 13616.ENSMODP00000023048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]