SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023093 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023093
Domain Number 1 Region: 565-852
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.64e-82
Family Protein kinases, catalytic subunit 0.000000000541
Further Details:      
 
Domain Number 2 Region: 1-174
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.25e-75
Family Ephrin receptor ligand binding domain 0.000000112
Further Details:      
 
Domain Number 3 Region: 302-507
Classification Level Classification E-value
Superfamily Fibronectin type III 4.14e-38
Family Fibronectin type III 0.00000302
Further Details:      
 
Domain Number 4 Region: 847-918
Classification Level Classification E-value
Superfamily SAM/Pointed domain 7.54e-20
Family SAM (sterile alpha motif) domain 0.00021
Further Details:      
 
Domain Number 5 Region: 232-305,340-359
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000198
Family Growth factor receptor domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023093   Gene: ENSMODG00000018518   Transcript: ENSMODT00000023505
Sequence length 922
Comment pep:novel chromosome:BROADO5:4:96076015:96580563:1 gene:ENSMODG00000018518 transcript:ENSMODT00000023505 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLMDTRTATAELGWTANPASGWEEVSGYDENLNTIRTYQVCNVFEPNQNNWLLTTFIHRR
GAHRIYTEMRFTVRDCSSLPNVPGSCKETFNLYYYETDSVIATKKSAFWTEAPYLKVDTI
AADESFSQVDFGGRLMKVNTEVRSFGPLTRNGFYLAFQDYGACMSLLSVRVFFKKCPSIV
QNFAIFPETMTGAESTSLVIARGTCIPNAEEVDVPIKLYCNGDGEWMVPIGRCTCKAGYE
PENNVVCKACPAGMFKANQEVGVCSQCPSNSRSPSEASPICTCRTGYYRADFDPPEVACT
SVPSGPRNVISIVNETSIILEWHPPRETGGRDDVTYNIVCKKCRADRRSCSRCDDNVEFV
PRQLGLTESRVFISSLWAHTPYTFDIQAINGVSGKSPFPPQHVSVNITTNQAAPSTVPIM
HQVSATMRSITLSWPQPEQPNGIILDYEIRYYEKEQNEYNSSMAKSQTNTARIDGLRPGM
VYVVQVRARTVAGYGKYSGKMCFQTLTDDDYKSELREQLPLIAGSAAAGVVFIVSLVAIS
IVCSRKRAYSKEAVYSDKLQHYSTGRGEFGEVYKGRLKLPGKREIYVAIKTLKAGYSEKQ
RRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMIITEFMENGALDSFLRQNDGQFTVIQL
VGMLRGIAAGMKYLSEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYLQDDTSDPTYTSS
LGGKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDY
RLPPPMDCPAALHQLMLDCWQKDRNTRPRFTEIVNTLDKMIRNPASLKTVATITAVPSQP
LLDRSIPDFTAFTSVDDWLNAIKMVQYRDSFLTAGFTSLQLVTQMTSEDLLRIGVTLAGH
QKKILNSVHSMRVQMSQSPTSM
Download sequence
Identical sequences F7AG95
ENSMODP00000023093 ENSMODP00000023093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]