SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023124 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023124
Domain Number 1 Region: 28-123
Classification Level Classification E-value
Superfamily Fibronectin type III 2.8e-22
Family Fibronectin type III 0.0022
Further Details:      
 
Domain Number 2 Region: 117-219
Classification Level Classification E-value
Superfamily Fibronectin type III 5.09e-16
Family Fibronectin type III 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023124   Gene: ENSMODG00000018541   Transcript: ENSMODT00000023537
Sequence length 311
Comment pep:novel chromosome:BROADO5:4:98827231:98854183:1 gene:ENSMODG00000018541 transcript:ENSMODT00000023537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLKEASADLLVALLYTLMPALLPDAAAILPAPLDLSVHSINMKHILTWSPVIVPGKIVN
YSVEYQGEYERYYTSSTWIPSSWCSSISTPECNVTDDITATVAYNFRVRATLGNQSSAWS
TLKELFNRNSTILTSPRMKMSKDGYHLIVEFEDLGPYFEFNVTYWRKSPNSQVLYKIVRE
GGSLVHLETMEAGAEYCVKAQTIVEVIERSSAFNQVECVIAQDESPLLVLVLFASVAFVL
FLVGVPLLVWKMSQLLRYSCCPVVVLPDTLKITDSPQKLISCKREDVEPCDTIVRVMYPE
ELFRSWIQEAL
Download sequence
Identical sequences F7GD26
ENSMODP00000023124 XP_007493982.1.35504 ENSMODP00000023124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]