SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023214 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023214
Domain Number 1 Region: 609-703
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000644
Family Fibronectin type III 0.0026
Further Details:      
 
Domain Number 2 Region: 287-341
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000458
Family B-box zinc-binding domain 0.0022
Further Details:      
 
Domain Number 3 Region: 142-216
Classification Level Classification E-value
Superfamily RING/U-box 0.000000989
Family RING finger domain, C3HC4 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023214   Gene: ENSMODG00000018613   Transcript: ENSMODT00000023628
Sequence length 725
Comment pep:novel chromosome:BROADO5:4:104102819:104160736:1 gene:ENSMODG00000018613 transcript:ENSMODT00000023628 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEPMCILSPCCPWERIIPKECMCPSMKFLLTTERNCSCFPCPYDEDSAYQFCHCTCSDY
PNCHWCCCACANDPVWKCCCVCPRGSSGFRFYPWHLGQKREIYTKDQPRLLTSALNSRFF
QMNSTDSCDYLLKLPKGNLVNHLVCPLCKKLRMHSYILPCQHCICQVCLKKVQEAAEITE
IFTIIACPVCHSTHCLHKTDKVLLPEHYLRNRLAKRFMQENNIPTWRFDPASKPVFCQLC
KNNRLAVKYCTTCNMNFCSECLRTQHMGVTMQDHFFMDVSSQEKIEKHCIYHPNNKLIEY
CKTDNELLCGLCKSIYHEGHDSLPMVEASSQLSAALFSAMARFKTARHEIDNDLIEFSIL
KNSVKFQKDQKRKEIRSGFIRLRHILQEKEKACMEQMEKLEGNRQKEINKYVCTTTLKIK
TMDGLLDFCKEALKETSQVAFLQSAKSLVDQIDNGLRNIYRPDPLLKADCTVALQLNFLE
LANALNSLFPNRQKEAGDSPPSPYPMHPEMMISRKVTFSTQNFTGRPICQRSCSSQSVHS
NPPNQGKTFLEAYGRTQSIPTSKGPEGYSTYWATPHESTWGADPSKIQTYSSFHNWYITH
EGNLKVPGLIAIYQTLVYPRAAKIYWTCPTEDVDSFEMEFYELSICSNNIRTELCGHIQD
IMQQNLELHNLTPGTEYLFKVRAVNDNGPGEWSDMCKVVTPDGRGKPRAKWGLLKNIQSV
LLKRS
Download sequence
Identical sequences F7BPR2
ENSMODP00000023214 XP_003341245.1.35504 ENSMODP00000023214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]