SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023261 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023261
Domain Number 1 Region: 124-219
Classification Level Classification E-value
Superfamily Immunoglobulin 3.94e-22
Family I set domains 0.0021
Further Details:      
 
Domain Number 2 Region: 221-317
Classification Level Classification E-value
Superfamily Immunoglobulin 6.38e-21
Family I set domains 0.0017
Further Details:      
 
Domain Number 3 Region: 321-415
Classification Level Classification E-value
Superfamily Immunoglobulin 5.38e-20
Family I set domains 0.0024
Further Details:      
 
Domain Number 4 Region: 27-121
Classification Level Classification E-value
Superfamily Immunoglobulin 7.53e-18
Family I set domains 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023261   Gene: ENSMODG00000018658   Transcript: ENSMODT00000023675
Sequence length 438
Comment pep:novel chromosome:BROADO5:Un:43057180:43135434:-1 gene:ENSMODG00000018658 transcript:ENSMODT00000023675 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPALSVLLCLGLCLCKRTRTQAAGELPRPSLRAENGSLVPHGGAVTLRCRGSWEAEEWR
LEKRGGSGWSQIKAVRGAGNEGEFSFLYVISHDAGTYRCLYRHSSYGLSELSDSLELVVT
DLSAPPSLAAEPSSEVASGMNVTLQCWSEGWHDWFALCKDGEEISRGRTGRHGWGRQADF
FFPAVTPTHIGTYRCFGFHNSSPSLWSSPSAPLLLWVSGLYAPPSLAAEPSSEVASGQNV
TLQCRSEQWYDWCVLCKEGEEISCGRTWSHGWGRQADFLFPAVTQTQEGTYRCFGFYSSS
PSQWSSPSAPLLLRVSGLSAPPSLAALPSSEVASGQRVTLQCRSERWYDWCVLCKDGEEI
SCRRTRSHGRGRQADFFFPAVTPTQDGTYRCFGFHSSYPNQWSSPSAPLLLRVSGEAAPG
PPSSPRLQLSQALSLLWD
Download sequence
Identical sequences H9H767
ENSMODP00000023261 ENSMODP00000023261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]