SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023511 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023511
Domain Number 1 Region: 28-186
Classification Level Classification E-value
Superfamily PR-1-like 1.83e-46
Family PR-1-like 0.00001
Further Details:      
 
Domain Number 2 Region: 185-240
Classification Level Classification E-value
Superfamily Crisp domain-like 4.5e-16
Family Crisp domain 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023511   Gene: ENSMODG00000018844   Transcript: ENSMODT00000023927
Sequence length 241
Comment pep:novel chromosome:BROADO5:2:296629502:296649271:-1 gene:ENSMODG00000018844 transcript:ENSMODT00000023927 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ITIFAPFALFFVVRIFILIDLLFLKSNYSLSTHNPSVQREIVNKHNELRRMANPTGGNIL
KMTWNEEAALNAEKWAKNCILSHSHDEQRSIIANCGENLFFSTSIRSWPDVIQVFFDEVK
IFKFGYGPIKKAKVLHYTQLVWATSHQLGCAMSHCPNQKMKYLYVCHYCPQGNGGDPYRP
YKKGEPCSDCPHHCDNGLCTNPCMYKDEEPNCSQLTKNSGCNNNSIKEKCQASCKCQTEI
K
Download sequence
Identical sequences F7DWI1
13616.ENSMODP00000023511 ENSMODP00000023511 ENSMODP00000023511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]