SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023556 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023556
Domain Number 1 Region: 596-886
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000439
Family Rhodopsin-like 0.026
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000023556
Domain Number - Region: 176-239
Classification Level Classification E-value
Superfamily SEA domain 0.00392
Family SEA domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023556   Gene: ENSMODG00000018880   Transcript: ENSMODT00000023974
Sequence length 928
Comment pep:novel chromosome:BROADO5:2:293127944:293190788:-1 gene:ENSMODG00000018880 transcript:ENSMODT00000023974 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FQGPYILLEAIGKSRMQKMKFGELCLVSLLTMAMASEVLLWRNKSLKTKKDLGVKKKSHE
GMVQEYELLLQVVYQHSVEKRDLQNFLESLKSQYSWPNGTLEIIRKKATTYCSSLNGILQ
CACEDSYHWFSHTCLDPRKCHFNKSGAHPSCDCQSNNLHDSITFCERTKIFGTFKINKKF
RKELLNSSSELYFNYTAGIEIQLKEAYKGVPGFDSVRVTQFREGNIIVGYEIIGSSSTSE
LLAAVMQVSGKVKSSLKKYYLIEENSLRVFGKADCDSIIFGFGSENDEYTLPCSAGYVGN
ITARCHSSAWQLVKEMCVPSQLEEMKKNLNAIEGNITEAAVFTVMQELSTILQQNPSTTA
GSLGSMVSILRSVSSLSLSSHVKLSTPTTKNFLSIVDHLLNSTTISNWTMLLQEERNASS
QLLETLEDISILVSSEIMPLTFSGKFINWDGIQATESQKQKGYNYHMELLQENNSVPIRG
TLSIGKDQFQKSLPQTIISMASLTLGSILPSISKQNAIVNGPVISTIIPNYSLEEIFLIF
SKIDSNLSKPYCVFWDFRHLEWNEAGCHLLKETHDTVKCRCTHLTSFSMLMSPFVPPTII
PVVKWITYLGLSVSIVSLILCLVIEALFWKQVKKNQTSHTRHICMVNVALSLLIADIWFI
IAATSDTQGNGSGVCVAAIFFTHFFYLSLFFWMLTLGILMVYRIVLVFHHMTLPTMMAIG
FSLGYGCPLLITIITIAASQPSNSYQRRDVCWLNWSEGAKPLLAFVVPALTIVAVNLIVV
LVVLLKLRRPTIGERLNREDKVTAIRIGKTLVILTPLLGLTWGFGIGTMVDSHSLTWHVI
FALLNAFQGFFILCFGILFDSKVRQLLFKKLFPISSSSMQPMKSTSDLAVGPKFLNTFSP
LNKTGAYTLSGIGESTSDIILTEFLSSE
Download sequence
Identical sequences F7DA61
ENSMODP00000023556 ENSMODP00000023556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]