SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023591 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023591
Domain Number 1 Region: 35-369
Classification Level Classification E-value
Superfamily L domain-like 1.02e-60
Family Ngr ectodomain-like 0.016
Further Details:      
 
Domain Number 2 Region: 418-503
Classification Level Classification E-value
Superfamily Immunoglobulin 9.28e-19
Family I set domains 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023591   Gene: ENSMODG00000018908   Transcript: ENSMODT00000024010
Sequence length 593
Comment pep:novel chromosome:BROADO5:2:497105841:497107622:-1 gene:ENSMODG00000018908 transcript:ENSMODT00000024010 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVIDIISRWASASWPPLFFLLLLAGRSGRGCPAACDCDSQPQAVICASRLLEAVPGGIPP
DTELLDLSRNRLWGLQRGMLSRLGPLLELDLSHNQLSTLEPGAFQGLRNLLTLRLRGNRL
RIVAPGVFSGLTSLTLLDLSLNQIVLFLDGAFGGLSSLQQLEVGDNHLVFVAPGAFVGLA
KLSILTLERCNLSTVPGPALARLPGLIGLRLRELDIGRLPTGALRGLGQLRELEIHQWPS
LRALEPGSLAGLNLSSLAITYCNLSSVPFQALSHLSFLRVLDLSQNPISNIPARKLSFLV
RLQELHLAGAHLASIAAHAFHGLAAFCLLDVANNALQTLEEAAFPSPSSLVTLRLAGNPL
ICDCRLLWLLRLRHHLDFGKSPPACASPLHVRGKNLRDFSDILPPGHFTCRAALIQRSGP
RRVSAEEGQQAVFSCSGDGDPAPTVSWQGPQGTWLGRTGRVRVLEDGTLEIRAIQLGDGG
AYVCVLSNVAGNDSLSTWLEVIRIEPPNGTLTDTNGTTLGTPGPFFLDSRGLVVVLAVGF
LPFLTSVTLCFGLIALWSKSKGRVKHHTTFDFVLPRSSGEGGAGGNRVTAKLF
Download sequence
Identical sequences F7C787
ENSMODP00000023591 13616.ENSMODP00000023591 ENSMODP00000023591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]