SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023690 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023690
Domain Number 1 Region: 779-1060
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.53e-69
Family Protein kinases, catalytic subunit 0.00000107
Further Details:      
 
Domain Number 2 Region: 594-686
Classification Level Classification E-value
Superfamily Immunoglobulin 9.7e-22
Family I set domains 0.013
Further Details:      
 
Domain Number 3 Region: 412-501
Classification Level Classification E-value
Superfamily Immunoglobulin 2.04e-20
Family I set domains 0.018
Further Details:      
 
Domain Number 4 Region: 127-213
Classification Level Classification E-value
Superfamily Immunoglobulin 9.03e-18
Family I set domains 0.015
Further Details:      
 
Domain Number 5 Region: 502-589
Classification Level Classification E-value
Superfamily Immunoglobulin 5.52e-16
Family I set domains 0.015
Further Details:      
 
Domain Number 6 Region: 328-418
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000493
Family I set domains 0.019
Further Details:      
 
Domain Number 7 Region: 226-321
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000957
Family I set domains 0.017
Further Details:      
 
Domain Number 8 Region: 31-113
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000221
Family I set domains 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023690   Gene: ENSMODG00000018983   Transcript: ENSMODT00000024110
Sequence length 1070
Comment pep:novel chromosome:BROADO5:2:287220902:287313552:1 gene:ENSMODG00000018983 transcript:ENSMODT00000024110 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPEPRAPGSPRRPPLLSFLLLLGATGTRAAIRFTKEPSSQDALQGRRALLRCEVESPGR
VQVHWLLNGVPVQDSERRFTKGNNLSFAAVDRLQDAGAFQCVARDNDTGEEIHSANASFN
IKWIESGPVILKHPASLAEIQPQTLVTLRCHIDGHPRPTYQWFRDSNPLSDSQGNYSVSS
KERNLTLRRASPEHSGVYSCCAHNSFGHICSSQNITLSIADESFARPLVVPQDQVVGRNE
DAMFHCQFTAQPPPTLQWFFEGDSPINNRSRIHHLRRATVFSNGSLLLPQVRPRSAGVYR
CVGRGQRGPPVILEATLHLEEIEDMPPFQPRVFTVGREERVACIAPQGVPEPSVWWERAG
AQVPHHGKVYQEGHVLVFANTTENDAGTYVCHAANQAGQRHQEVNITVATLPRWLKKPQD
SQLEEGKPGYLHCLSQATPKPTVVWYRNQMLISEDSRFEISENGTLRINSVEVYDGNLYR
CVSSTPAGSIEAQARVQVLEKLKFTPPPQPQQCMEFDKEATVSCSATGREKPTIRWMRAD
GSSLPASVTDNAGTLHFSRVTRSDAGNYTCIASNEPQGQISAHVQLTVAVFITFKREPER
TTVYQGHTAMLQCEAQGDPDPLIQWKGKNRILDPAQLGPRMHIFSNGSLVIHDVTSEDSG
RYTCIAGNSCNIKHTEASLHVVDKPVLDSSEGPGSPPPYKMIQTIGLSVGAAVAYIIAVL
GLMFYCKKRCKAKRLQKQPEGEEPEMECLNGGPMQNGQPTAEIREEVALTNLGPGSSAAN
KRHSTSDKMHFPRANLQSITTLGKSDFGDVFLAKAQGLEEGVAETLVLVKSLQSRDEQLQ
LNFRREFEMFGKLSHANLVRLLGLCREAEPHYMILEYVDLGDLKQFLRISKSKDEKLKPQ
PLSTKQKVSLCTQVALGMEHLSNSRFVHRDLAARNCLISAQRQVKVSSLGLSKDVYNSEY
YHFRHAWIPLRWMPPEAVLEGDFSTKSDVWAFGVLMWEVFTHGEMPHDGQADDEVLADLQ
AGKARLPQPEGCPAKLYRLMQRCWAPSPKDRPSFSEIANVLGESSADGKP
Download sequence
Identical sequences F7FP29
ENSMODP00000023690 XP_007484005.1.35504 ENSMODP00000023690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]