SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023701 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023701
Domain Number 1 Region: 32-128
Classification Level Classification E-value
Superfamily Immunoglobulin 2.52e-17
Family I set domains 0.015
Further Details:      
 
Domain Number 2 Region: 174-227
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000123
Family EGF-type module 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023701   Gene: ENSMODG00000018991   Transcript: ENSMODT00000024123
Sequence length 647
Comment pep:novel chromosome:BROADO5:5:12000463:12227690:-1 gene:ENSMODG00000018991 transcript:ENSMODT00000024123 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEKKDGKARGKGKKKERGSSQKTSPLEGAAPPRLKEMKNQESTAGSKLVLRCETSSEYS
SLKFKWFKNGSELSRKNKPQNVKIQKKPGKSELRISKATLADSGEYMCKVISKLGNDSAY
ANITIVESNETVTSMPSSTERSSMPSEFPTRISMSTEGANTSSSTSTSTAGTSHLVKCSE
KDKTFCVNGGECFIVKDPSNPSRYSCKCPNEFTGDRCQNYVMASFYKHLGIEFMEAEELY
QKRVLTITGICIALLVVGIMCVVAYCKTKKQRKKLHDRLRQSLRSERNNMVNMANGPHHP
NPPPENVQLVNQYVSKNIISSEHVIERETETSFSASHCTSPAHHSMAATQTPSHSWSNGH
TESIISESHSVLVISSIENSRHTSPAGGPRGRLNGMGGPRECNSFLKHARETPDSYRDSP
HSERYVSAMTTPARMSPVDFYMPSSPKSPPSEMSPPISSLTVSMPSVAVSPLVEEERPLL
LVTPPRLREKKYDHHPQQFNSFHHNPVHESNSLPPSPLRIVEDEEYETTQEYETTQEYEP
AQEPTKKLVNSRRAKRTKPDGHISNRLEMDSDTSSESSNSESETEDERIGENTPFLSIQT
PMAAGLESAPAFRLADSRTNPTSRYSTQEEFQARLSSVIANQDPIAV
Download sequence
Identical sequences F7CPL9
ENSMODP00000023701 ENSMODP00000023701 XP_007495627.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]